close all open/close all

CDS information : Chart_00280


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction27,621 / 28,787 / + [in whole cluster]
8,041 / 9,207 / + [in contig]
Location27621..28787 [in whole cluster]
8041..9207 [in contig]
TypeCDS
Length1,167 bp (388 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA dehydrogenase
Product (GenBank)ChaO protein
Gene
Gene (GenBank)chaO
EC number1.3.99.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q937T2
PmId
[11571189] Cloning and genetic characterization of dca genes required for beta-oxidation of straight-chain dicarboxylic acids in Acinetobacter sp. strain ADP1. (Appl Environ Microbiol. , 2001)

close this sectionSequence

selected fasta
>putative acyl-CoA dehydrogenase [ChaO protein]
MSSLDLLSEDERFVVRTVRDFVDRDVKPVVRELERTDTYPEALIERMKELGVFGLAVPQE
YGGTPVSMPCYVLVTEELARGWMSLAGAMGGHTVVAKLLLHFGTEEQRQRHLPLMATGET
RATMALTETGGGSDLQAMRTVARREGDGYVVNGAKTWITNSRRSRLIALLCKTDPDAEPA
HSGMSVLLVEHGPGLTVSRDLPKLGYKGVESCELSFENHRARADALLGGVEGHGFAQMMR
GLETGRLQVAARALGVGRAALEDALAYAQERESFGKPIWQHQSIGNYLADMATSLTAARQ
LTLYAARRAEAGHRVDMEAGMAKLFASETAMQIALNAVRIHGGYGYSTEFDVERYFRDAP
LMIVGEGTNEIQRNIIADRLVKRGGLDV
selected fasta
>putative acyl-CoA dehydrogenase [ChaO protein]
ATGAGCAGTCTCGACCTCCTGTCCGAGGACGAGCGGTTCGTCGTCAGGACGGTGCGCGAC
TTCGTGGACAGGGACGTCAAGCCCGTCGTCCGGGAGCTGGAGCGCACCGACACATACCCC
GAAGCCCTCATCGAGCGGATGAAGGAACTCGGCGTCTTCGGACTCGCCGTCCCGCAGGAG
TACGGCGGCACACCCGTCTCCATGCCCTGCTACGTCCTCGTCACCGAGGAGCTGGCCCGG
GGCTGGATGAGCCTGGCCGGCGCGATGGGCGGGCACACCGTCGTCGCCAAGCTGCTGCTG
CACTTCGGCACCGAGGAGCAGCGGCAGCGCCACCTGCCCCTGATGGCCACCGGCGAGACC
CGCGCGACGATGGCACTGACCGAGACCGGCGGCGGCTCCGACCTCCAGGCGATGCGCACC
GTCGCCCGAAGGGAGGGCGACGGCTATGTGGTGAACGGCGCGAAGACGTGGATCACCAAC
TCCCGCCGCTCGCGGCTCATCGCCCTGCTGTGCAAGACCGACCCGGACGCCGAGCCCGCG
CACAGCGGCATGTCCGTCCTCCTCGTCGAGCACGGACCGGGCCTGACCGTCTCCCGTGAT
CTGCCCAAGCTCGGCTACAAGGGCGTGGAGAGCTGCGAGCTGTCCTTCGAGAACCACCGC
GCACGTGCCGACGCGCTGCTGGGGGGAGTGGAGGGGCACGGCTTCGCCCAGATGATGCGG
GGTCTGGAGACCGGCCGCCTCCAAGTCGCCGCCCGCGCCCTGGGCGTGGGCCGGGCCGCC
CTGGAGGACGCGCTCGCCTACGCGCAGGAACGCGAGTCCTTCGGCAAGCCGATCTGGCAG
CACCAGTCGATCGGCAACTACCTTGCCGACATGGCGACTTCGCTCACCGCCGCACGCCAG
CTCACCCTCTATGCCGCCCGTCGGGCGGAGGCCGGACACCGGGTGGACATGGAGGCCGGC
ATGGCGAAGCTCTTCGCCTCCGAGACGGCCATGCAGATCGCTCTCAACGCCGTCCGCATC
CATGGCGGCTACGGCTACTCGACCGAGTTCGACGTAGAGCGCTACTTCCGGGACGCGCCG
CTGATGATCGTCGGAGAGGGCACCAACGAGATCCAGCGCAACATCATCGCCGACCGGCTC
GTGAAGCGGGGAGGACTGGACGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006089 Acyl-CoA dehydrogenase, conserved site (Conserved_site)
 [125-137]  PS00072
PS00072   ACYL_COA_DH_1
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [232-380]  2.19999999999997e-47 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [123-219]  4.9e-32 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
 [123-174]  5.5e-19 PF02770
PF02770   Acyl-CoA_dh_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [8-119]  5.30000000000001e-30 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [232-382]  3.89999861795218e-51 SSF47203
SSF47203   AcylCoADH_C_like
 [220-384]  1.99999999999999e-59 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-231]  2.39999798157263e-70 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [7-120]  7.5e-37 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit