close all open/close all

CDS information : Chart_00290


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction28,975 / 29,721 / + [in whole cluster]
9,395 / 10,141 / + [in contig]
Location28975..29721 [in whole cluster]
9395..10141 [in contig]
TypeCDS
Length747 bp (248 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)chaQ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MCGRYASTRSPQDLAQLFEVTEWHPEETLAPSWNVAPTDDVWAVLERAPRGSDDDAPAVR
RLRPLRWGLVPSWAKDVKIGARMINARVETVHEKPAFRRAFVKRRCLLPADGFYEWDQVK
DAKSGKVRKQPYFIHPEDGQVLALAGLYEFWRDPAVKDGDDPAAWLLTCTIITTEATDAA
GRIHPRMPLALTPEHYDAWLDPHHQSTDDLRALLTTPADGQLDARPVSPAVNSVSNNGPQ
LLDEVPAP
selected fasta
>hypothetical protein [hypothetical protein]
ATGTGCGGCCGCTACGCCTCCACCCGCAGCCCCCAGGACCTGGCCCAGCTGTTCGAGGTC
ACCGAGTGGCACCCCGAGGAGACCCTCGCGCCGAGCTGGAACGTGGCCCCGACCGACGAC
GTCTGGGCGGTCCTGGAACGCGCTCCGCGGGGCTCCGACGACGACGCCCCGGCCGTGCGC
CGGCTGCGGCCGCTCCGCTGGGGCCTCGTGCCCTCCTGGGCGAAGGACGTGAAGATCGGC
GCGAGGATGATCAACGCGCGTGTGGAGACCGTGCACGAGAAGCCCGCCTTCCGCCGCGCG
TTCGTCAAACGCCGCTGCCTGCTGCCGGCCGACGGCTTCTACGAGTGGGACCAGGTCAAG
GACGCCAAGTCCGGCAAGGTCCGCAAGCAGCCCTACTTCATCCACCCGGAGGACGGGCAG
GTCCTGGCCCTCGCCGGTCTGTACGAGTTCTGGCGCGACCCGGCCGTCAAGGACGGCGAC
GATCCCGCCGCCTGGCTGCTGACCTGCACCATCATCACCACCGAGGCCACCGACGCGGCC
GGCCGCATCCACCCCCGTATGCCGCTCGCGCTCACCCCCGAGCACTACGACGCCTGGCTC
GACCCGCACCACCAGTCCACGGACGACCTGCGCGCCCTGCTCACCACGCCGGCCGACGGT
CAGCTCGACGCCCGCCCCGTCTCGCCCGCGGTGAACAGCGTCAGCAACAACGGCCCCCAG
CTCCTGGACGAGGTTCCCGCCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003738 Protein of unknown function DUF159 (Family)
 [1-239]  1.9e-64 PF02586
PF02586   DUF159
SignalP No significant hit
TMHMM No significant hit