close all open/close all

CDS information : Chart_00300


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction29,863 / 30,789 / + [in whole cluster]
10,283 / 11,209 / + [in contig]
Location29863..30789 [in whole cluster]
10283..11209 [in contig]
TypeCDS
Length927 bp (308 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter metal-binding protein
Product (GenBank)ChaT2 protein
Gene
Gene (GenBank)chaT2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Family/Domain
FD
IPR006127

close this sectionSequence

selected fasta
>putative ABC transporter metal-binding protein [ChaT2 protein]
MPLSSPRVHAALLTGTCLTLLVGCAGSSDTAGVHGPAAASVIPVVASTNVYGDLARRIGG
AKVQVTSIISDPDQDPHSYEASTRNQLALSKAEIVIENGGGYDDFVDRMLKSAGSSPGVI
NAVEVSGKTAPKGGELNEHVWYDFPTVAELADRIAIALGKADPADAATFTENAKDFVSLL
QPLERKEARIKAEHGGEAVAITEPVPLYMIEASGLRNATPEEFSEAIEEGDDVSPRTLQS
TLALFTGKKVEALVYNEQTSGPQTEKAERVAEAAGIPVVPVTETLPKGKDYLAWMTANVD
ALASALAK
selected fasta
>putative ABC transporter metal-binding protein [ChaT2 protein]
ATGCCCCTGTCCTCACCCCGCGTGCACGCGGCCCTGCTGACCGGCACCTGCCTGACTCTC
CTCGTCGGCTGTGCCGGCTCCTCGGACACCGCCGGGGTGCACGGTCCCGCCGCGGCCTCC
GTCATCCCCGTCGTGGCCTCGACGAACGTCTACGGGGACCTGGCCAGGCGAATAGGCGGC
GCCAAGGTCCAGGTCACCTCGATCATCAGCGACCCCGACCAGGACCCGCACTCCTACGAG
GCGAGCACCCGCAACCAACTGGCGCTGTCCAAGGCCGAGATCGTCATCGAGAACGGCGGC
GGCTACGACGACTTCGTCGACCGCATGCTGAAGAGCGCGGGCTCGTCCCCCGGCGTGATC
AACGCCGTCGAGGTGTCAGGGAAGACCGCCCCGAAGGGCGGCGAGCTCAACGAGCATGTC
TGGTACGACTTCCCGACGGTCGCCGAACTCGCCGACCGCATCGCCATCGCACTCGGCAAG
GCCGACCCGGCCGACGCCGCGACCTTCACCGAGAACGCGAAGGACTTCGTAAGCCTCCTT
CAGCCGCTGGAGCGCAAAGAGGCCCGGATCAAGGCCGAGCACGGCGGCGAGGCGGTGGCC
ATCACCGAGCCCGTCCCGCTGTACATGATCGAGGCCAGTGGGCTGAGGAACGCCACACCC
GAGGAGTTCAGCGAGGCGATCGAGGAAGGCGACGATGTCTCCCCGAGGACCCTCCAGAGC
ACCCTGGCGCTGTTCACCGGCAAGAAGGTCGAGGCGCTGGTCTACAACGAGCAGACCTCC
GGCCCGCAGACCGAGAAGGCGGAGCGCGTGGCCGAGGCCGCCGGCATCCCGGTCGTGCCC
GTCACCGAGACCCTCCCCAAGGGCAAGGACTACCTCGCCTGGATGACCGCCAACGTGGAC
GCGCTCGCGAGCGCGCTGGCCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006127 ABC transporter, metal-binding lipoprotein (Family)
 [44-306]  4.30000000000003e-49 PF01297
PF01297   SBP_bac_9
SignalP
 [1-26]  0.991 Signal
Eukaryota   
 [1-27]  0.976 Signal
Bacteria, Gram-negative   
 [1-39]  1 Signal
Bacteria, Gram-positive   
TMHMM No significant hit