close all open/close all

CDS information : Chart_00310


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction30,846 / 31,655 / + [in whole cluster]
11,266 / 12,075 / + [in contig]
Location30846..31655 [in whole cluster]
11266..12075 [in contig]
TypeCDS
Length810 bp (269 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)ChaT3 protein
Gene
Gene (GenBank)chaT3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
P0A9X1
PmId
[9680209] The ZnuABC high-affinity zinc uptake system and its regulator Zur in Escherichia coli. (Mol Microbiol. , 1998)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [ChaT3 protein]
MADALISLRRAALSYGERVVWRDLDLDVRPGEFLAVLGPNGAGKTSFVRALLGQRRLSAG
TLTVLGRPPGRGSRHIGYVPQQAALSAQAMLRARDLVRLGVDGHRFGPRPRTGAVRRRAD
EILASVGATAYADVPVALLSGGERQRVRIGQALATDPRILLCDEPLLSLDLHHQRAVTEL
VDARRRSHGTAVVFVTHEINPVLGLVDRVLYLARGGHRVGTPDEVLTSEALSRLYGTQVD
VVRVRDRVVVVGAPEEAAHHPQLPGGARP
selected fasta
>putative ABC transporter ATP-binding protein [ChaT3 protein]
ATGGCCGACGCGCTGATCAGTCTGCGGCGAGCGGCCCTGTCGTACGGCGAGCGCGTGGTG
TGGCGGGACCTCGATCTCGACGTGCGGCCGGGCGAGTTCCTGGCCGTGCTCGGGCCCAAC
GGGGCCGGGAAGACCAGCTTCGTGCGCGCGCTGCTCGGGCAGCGCCGGCTGTCCGCCGGC
ACGCTCACGGTGCTGGGCCGTCCGCCCGGCCGCGGCAGCCGGCACATCGGCTACGTCCCC
CAGCAGGCGGCCCTGTCCGCACAGGCCATGCTGCGTGCCCGGGACCTCGTCCGTCTCGGC
GTCGACGGGCACCGCTTCGGGCCTCGGCCGCGCACGGGCGCCGTACGCCGCCGCGCGGAC
GAGATCCTCGCCTCGGTCGGGGCCACGGCGTACGCCGACGTCCCCGTCGCCCTGCTCTCC
GGCGGCGAACGGCAACGCGTGCGCATCGGGCAGGCCCTCGCGACCGACCCCCGCATCCTG
CTCTGCGACGAACCCCTGCTCTCCCTCGACCTGCACCACCAGCGGGCCGTCACGGAACTG
GTCGACGCACGGCGCCGCTCCCACGGCACCGCGGTGGTCTTCGTCACCCACGAGATCAAC
CCCGTGCTGGGCCTCGTGGACCGCGTGCTGTACCTCGCCCGCGGCGGCCACCGCGTCGGC
ACGCCCGACGAGGTCCTCACCTCCGAGGCGCTGTCGCGGCTGTACGGCACACAGGTCGAC
GTCGTCCGTGTCCGCGACCGCGTGGTGGTCGTCGGCGCACCCGAAGAGGCGGCCCACCAT
CCCCAACTGCCCGGCGGAGCAAGGCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [46-166]  9.10000000000001e-15 PF00005
PF00005   ABC_tran
 [6-239]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [30-216]  4.50000034739347e-14 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [139-153]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit