close all open/close all

CDS information : Chart_00320


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction31,652 / 32,521 / + [in whole cluster]
12,072 / 12,941 / + [in contig]
Location31652..32521 [in whole cluster]
12072..12941 [in contig]
TypeCDS
Length870 bp (289 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter permease protein
Product (GenBank)ChaT4 protein
Gene
Gene (GenBank)chaT4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
Q9RNI8
PmId
[10564500] Identification and characterization of a Streptococcus pyogenes ABC transporter with multiple specificity for metal cations. (Mol Microbiol. , 1999)

close this sectionSequence

selected fasta
>putative ABC transporter permease protein [ChaT4 protein]
MTLAQGIWQQIFAFDHYGELLALVRNSLAAGAALGLVGGLVGVFVIMRDLPFAVHGISEL
SFAGASAALLLGVNVVAGSIVGSLVAAGAIGLLGARARDRNSVIGVIMPFGLGLGVLFLA
LYKGRAANKFGLLTGQIVAVDTPQMSWLLGTSAVVLVALAVMWRPLVFASADAEVAEARG
VPVRGMSFAFMIVLGLAVALSVQIVGALLVLTLVVTPAAAAARVTASPVLLPVLSAVFAV
ASIEGGILLALGSSIPISPYVTTISFGIYLVCRRFGGKRARTGGVGVQG
selected fasta
>putative ABC transporter permease protein [ChaT4 protein]
ATGACCCTCGCCCAGGGAATCTGGCAGCAGATCTTCGCCTTCGACCACTACGGCGAACTG
CTCGCCCTCGTCCGGAACTCGCTCGCCGCCGGGGCCGCGCTCGGGCTGGTCGGCGGCCTG
GTGGGCGTGTTCGTGATCATGCGGGACCTGCCGTTCGCGGTGCACGGGATCAGCGAGCTG
TCGTTCGCCGGGGCCTCGGCCGCGCTGCTGCTGGGCGTGAACGTCGTGGCCGGGTCGATC
GTCGGCTCCCTCGTCGCGGCGGGGGCCATCGGGCTGCTCGGGGCGCGGGCCCGGGACCGC
AACTCGGTGATCGGCGTCATCATGCCGTTCGGCCTCGGGCTCGGCGTGCTGTTCCTCGCG
CTGTACAAGGGCCGCGCGGCGAACAAGTTCGGCCTGTTGACCGGGCAGATCGTCGCCGTC
GACACCCCGCAGATGTCCTGGCTGCTCGGCACGTCGGCGGTGGTGCTGGTCGCGCTCGCG
GTGATGTGGCGACCGCTCGTCTTCGCCAGTGCCGACGCGGAGGTGGCCGAGGCGCGGGGC
GTGCCGGTGCGGGGAATGTCCTTCGCCTTCATGATCGTGCTGGGCCTCGCGGTCGCGCTG
TCCGTCCAGATCGTCGGCGCCCTTCTGGTCCTGACCCTCGTCGTCACACCCGCGGCGGCC
GCGGCTCGCGTCACGGCCTCGCCGGTGCTGCTTCCCGTCCTGAGCGCGGTGTTCGCGGTG
GCCTCCATCGAGGGCGGCATCCTGCTGGCCCTCGGCAGCAGCATCCCCATCAGCCCGTAC
GTCACCACGATCTCGTTCGGCATCTACCTCGTGTGCAGGCGTTTCGGCGGCAAACGGGCC
CGGACCGGTGGGGTCGGCGTGCAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001626 ABC-3 (Family)
 [23-271]  2.70000000000002e-42 PF00950
PF00950   ABC-3
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-32]  0.27 Signal
Bacteria, Gram-positive   
TMHMM
 [26-48]  Transmembrane (i-o) [68-90]  Transmembrane (o-i) [103-122]  Transmembrane (i-o) [145-167]  Transmembrane (o-i) [180-199]  Transmembrane (i-o) [203-222]  Transmembrane (o-i) [229-251]  Transmembrane (i-o) [255-272]  Transmembrane (o-i)
Transmembrane 8