close all open/close all

CDS information : Chart_00330


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction32,568 / 34,631 / + [in whole cluster]
12,988 / 15,051 / + [in contig]
Location32568..34631 [in whole cluster]
12988..15051 [in contig]
TypeCDS
Length2,064 bp (687 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative cation-transporting ATPase
Product (GenBank)ChaT5 protein
Gene
Gene (GenBank)chaT5
EC number3.6.3.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
O31688
PmId
[12180919] A peroxide-induced zinc uptake system plays an important role in protection against oxidative stress in Bacillus subtilis. (Mol Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative cation-transporting ATPase [ChaT5 protein]
MPATLTPPAADPAASVRAGAVPRRRTRLLALPEVRRAAAATALFLLALPLQLAGAPALIW
GALYVLSYATGGWEPGWEGLKALKGRTLDVDLLMVVAALGAASIGQVMDGALLIVIFATS
GALEALATARTADSVRGLLDLAPATATRIAADGTEQTLPVDELAVGDTVLVRPGERVGAD
GRVLDGASEVDQTSITGEPLPALKEPGDEVFAGTLNGTGALRVRVERDASDSVIARIVRM
VEEASETKAPTQLFIEKVEQRYSLGMVAATLAVFGVPLAFGEAFSEALLRGMTFMIVASP
CAVVLATMPPLLSAIANAGRHGVLVKSAVAMERLGQIDAVALDKTGTLTEGTPRVVDVRP
LRERGLDEVELLTFAAAAEHPSEHPLARAVVDAARERGLDLPATEGFTSAPGIGVMAVVG
GRTVQVGAPARLLAEAEAEVEVEVEAKCAADAGGDTDGVVAALVRELEESGRSAVLVVVD
GTPAGVLGIADRLRPDAAATVAALTVLTGTAPTLLTGDNPRAAARLAAEAGVEDVRAGLL
PQEKVGAVRELEGAGRRVMVVGDGVNDAPALAAAHIGVAMGRAGSDLALETADAVIVRDE
LVAVPATVALSRRARELVVQNLVIAGVFIAGLVVWDLAGTLPLPLGVAGHEGSTVLVGLN
GLRLLRDSAWKRAAPEGTGTPAGAAKL
selected fasta
>putative cation-transporting ATPase [ChaT5 protein]
ATGCCTGCCACGCTCACCCCACCCGCGGCCGACCCCGCCGCCTCCGTGCGCGCCGGAGCC
GTCCCCAGGCGGCGCACCCGGCTGCTCGCGCTGCCGGAGGTCCGCCGGGCCGCCGCGGCC
ACCGCGCTGTTCCTGCTCGCGCTGCCGCTCCAGCTCGCCGGAGCGCCCGCCTTGATCTGG
GGTGCGCTGTACGTGCTGTCGTACGCCACCGGCGGCTGGGAGCCGGGCTGGGAAGGGCTC
AAGGCGCTCAAGGGCAGGACCCTCGACGTCGATCTGCTGATGGTCGTCGCCGCGCTCGGC
GCCGCATCGATCGGGCAGGTCATGGACGGCGCCCTGCTGATCGTCATCTTCGCGACCTCC
GGCGCGCTGGAGGCGCTCGCCACCGCCCGCACCGCCGACTCGGTGCGCGGCCTGCTCGAC
CTGGCGCCCGCCACGGCCACCCGCATCGCCGCCGACGGCACCGAACAAACCCTCCCCGTC
GACGAGTTGGCGGTCGGCGACACCGTCCTCGTACGGCCCGGCGAGCGCGTCGGGGCCGAC
GGGCGGGTGCTCGACGGAGCGAGCGAGGTGGATCAGACGAGCATCACCGGCGAGCCGCTC
CCGGCGTTGAAGGAGCCGGGCGACGAAGTCTTCGCGGGCACGCTCAACGGCACCGGCGCG
CTGCGCGTCCGGGTCGAACGGGACGCCTCCGACTCCGTGATCGCCCGCATCGTACGGATG
GTGGAGGAGGCGTCGGAGACCAAGGCGCCCACGCAGCTGTTCATCGAGAAGGTCGAACAG
CGTTACTCGCTGGGCATGGTGGCCGCGACGCTCGCCGTGTTCGGTGTGCCGCTCGCGTTC
GGTGAGGCGTTCTCCGAGGCGCTGCTGCGTGGGATGACCTTCATGATCGTGGCCTCGCCG
TGCGCGGTGGTCCTGGCCACCATGCCACCCCTGCTGTCGGCCATCGCCAACGCCGGCCGG
CACGGCGTGCTGGTGAAGTCGGCCGTGGCGATGGAACGCCTCGGCCAGATCGACGCCGTG
GCGCTGGACAAGACCGGCACGCTCACGGAGGGGACGCCACGGGTCGTCGACGTACGGCCG
CTGCGTGAACGTGGCCTGGACGAGGTCGAGTTGCTGACGTTCGCCGCGGCGGCCGAGCAC
CCCAGCGAGCACCCGCTGGCCCGCGCGGTGGTGGACGCGGCACGCGAGCGTGGCCTCGAC
CTGCCGGCCACCGAGGGCTTCACATCCGCGCCCGGGATCGGCGTCATGGCCGTCGTCGGG
GGCCGTACGGTCCAGGTGGGCGCCCCGGCGCGGCTGCTCGCCGAAGCCGAAGCCGAGGTA
GAGGTTGAAGTCGAGGCCAAGTGCGCAGCCGATGCCGGCGGCGACACCGACGGCGTGGTC
GCGGCACTGGTCCGGGAACTGGAGGAGTCCGGCCGTAGCGCCGTCCTCGTGGTCGTCGAC
GGAACCCCGGCCGGTGTGCTCGGCATCGCCGACCGGCTGCGTCCCGACGCGGCCGCCACG
GTCGCCGCTCTGACCGTCCTCACCGGCACCGCCCCGACCCTCCTCACCGGCGACAACCCC
CGTGCCGCCGCGCGCCTGGCAGCCGAGGCCGGTGTCGAGGACGTGCGGGCCGGGCTGCTG
CCGCAGGAAAAGGTGGGCGCGGTGCGGGAGTTGGAGGGTGCGGGGCGCCGGGTGATGGTC
GTCGGGGACGGCGTCAACGACGCGCCCGCGCTGGCCGCCGCGCACATCGGCGTCGCCATG
GGCCGAGCCGGCTCCGACCTCGCCCTGGAGACCGCCGACGCGGTGATCGTGCGCGACGAG
CTCGTCGCCGTACCCGCCACCGTCGCCCTGTCCCGCCGCGCCCGCGAGCTGGTCGTGCAG
AACCTCGTGATCGCCGGGGTGTTCATCGCCGGCCTGGTCGTCTGGGACCTGGCCGGGACG
CTGCCGCTGCCTCTCGGGGTCGCGGGCCACGAGGGCTCCACGGTCCTCGTCGGCCTGAAC
GGACTGCGCCTGCTGCGGGACTCGGCCTGGAAGCGGGCGGCGCCGGAGGGAACCGGGACC
CCGGCGGGTGCCGCAAAGTTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001366 ATPase, P-type, cadmium-transporting (Family)
 [54-71]  1.79999951654677e-08 PR00941 [125-145]  1.79999951654677e-08 PR00941 [207-223]  1.79999951654677e-08 PR00941 [226-240]  1.79999951654677e-08 PR00941
PR00941   CDATPASE
IPR001757 ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter (Family)
 [191-205]  9.30000048475975e-24 PR00119 [341-355]  9.30000048475975e-24 PR00119 [485-496]  9.30000048475975e-24 PR00119 [508-518]  9.30000048475975e-24 PR00119 [561-580]  9.30000048475975e-24 PR00119 [585-597]  9.30000048475975e-24 PR00119
PR00119   CATATPASE
 [114-376]  5.19999999999996e-37 TIGR01494 [464-625]  1.8e-28 TIGR01494
TIGR01494   ATPase_P-type
IPR005834 Haloacid dehalogenase-like hydrolase (Domain)
 [337-574]  1.5e-37 PF00702
PF00702   Hydrolase
IPR006416 ATPase, P-type, heavy metal translocating (Family)
 [90-664]  TIGR01525
TIGR01525   ATPase-IB_hvy
IPR008250 ATPase, P-type, ATPase-associated domain (Domain)
 [113-332]  1.40000000000001e-46 PF00122
PF00122   E1-E2_ATPase
IPR018303 ATPase, P-type phosphorylation site (PTM)
 [343-349]  PS00154
PS00154   ATPASE_E1_E2
IPR023214 HAD-like domain (Domain)
 [337-612]  2.69998997787809e-41 SSF56784
SSF56784   HAD-like_dom
 [331-355]  1.9e-34 G3DSA:3.40.50.1000 [491-625]  1.9e-34 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
IPR023299 ATPase, P-type, cytoplasmic domain N (Domain)
 [356-490]  3.90000000000001e-24 G3DSA:3.40.1110.10
G3DSA:3.40.1110.10   ATPase_P-typ_cyto_domN
IPR023300 ATPase, P-type, cytoplasmic transduction domain A (Domain)
 [92-242]  2.80000000000001e-23 G3DSA:2.70.150.10
G3DSA:2.70.150.10   ATPase_P-typ_cyto_domA
SignalP
 [1-57]  0.974 Signal
Eukaryota   
 [1-39]  0.432 Signal
Bacteria, Gram-positive   
TMHMM
 [42-64]  Transmembrane (i-o) [95-117]  Transmembrane (o-i) [262-284]  Transmembrane (i-o) [294-316]  Transmembrane (o-i) [617-639]  Transmembrane (i-o)
Transmembrane 5