close all open/close all
Chart_00330 Chart_00330   last last

CDS information : Chart_00340


close this sectionLocation

Organism
StrainHKI-249
Entry nameChartreusin
Contig
Start / Stop / Direction35,793 / 34,726 / - [in whole cluster]
16,213 / 15,146 / - [in contig]
Locationcomplement(34726..35793) [in whole cluster]
complement(15146..16213) [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LacI family transcriptional regulator
Product (GenBank)ChaR3 protein
Gene
Gene (GenBank)chaR3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15911378] Biosynthesis of the antitumor agent chartreusin involves the oxidative rearrangement of an anthracyclic polyketide. (Chem Biol. , 2005)
Related Reference
ACC
P03023
PmId
[2178920] Mutant lac repressors with new specificities hint at rules for protein--DNA recognition. (EMBO J. , 1990)
[8638105] Crystal structure of the lactose operon repressor and its complexes with DNA and inducer. (Science. , 1996)
[10647179] The solution structure of Lac repressor headpiece 62 complexed to a symmetrical lac operator. (Structure. , 1999)

close this sectionSequence

selected fasta
>putative LacI family transcriptional regulator [ChaR3 protein]
MTRGSADDSAPRGRSRRNFAGSRPVMDDVARLAGVSKQTVSRVLNDHPSVRAETRETVLS
AMRTLGYRPSRSARSLASGRTRMVGVISFDAARYGPASILTAINTAAQEAGYLLSSIALD
TAEPDTVVEAVNRLSAEGADGVIAIAPQLWVGKALADTRLDTPLVVLENGVDADTQQVTG
DSRAGARKAVGYLLDLGHRTVWHVAGPTGWTSADHRLGSWQACLEAAGAAVPTPLIGDWS
ADSGYELGRRLARRTDVTAVFASNDQMALGLLHALHEAGRSVPGDISVVGYDDIPEAAHF
LPPLTTVRTDFAEIGTRSLRLLLDRLDGTEEPARTRSLVPVDLVIRASSGPPPTR
selected fasta
>putative LacI family transcriptional regulator [ChaR3 protein]
ATGACCCGAGGCTCCGCCGACGACTCCGCTCCACGGGGGCGCAGCAGACGGAACTTCGCG
GGCTCGCGCCCCGTGATGGACGACGTGGCCCGGCTGGCGGGCGTCTCCAAGCAGACCGTC
TCCCGCGTCCTCAACGACCATCCGTCGGTGCGGGCCGAGACCCGCGAGACAGTGCTGAGC
GCCATGCGCACGCTGGGCTACCGGCCGAGCCGCAGTGCCCGTTCGCTGGCCAGCGGGCGG
ACCCGGATGGTCGGCGTGATCTCCTTCGACGCCGCCCGCTACGGCCCCGCCTCGATCCTG
ACCGCGATCAACACCGCTGCGCAGGAAGCCGGTTACCTGCTCAGCTCGATCGCCCTGGAC
ACCGCGGAACCCGACACGGTGGTCGAGGCGGTGAACCGGCTGTCCGCCGAGGGCGCGGAC
GGGGTGATCGCCATCGCCCCTCAGCTGTGGGTCGGCAAGGCTCTGGCGGACACTCGTCTC
GACACCCCGCTGGTCGTGCTGGAGAACGGCGTCGACGCCGACACCCAGCAGGTCACCGGC
GACTCCCGGGCCGGTGCCCGCAAGGCGGTCGGGTATCTGCTGGACCTGGGGCACCGTACG
GTGTGGCACGTCGCCGGCCCGACCGGCTGGACCTCGGCCGATCACCGGCTGGGCAGCTGG
CAGGCCTGTCTGGAGGCGGCCGGCGCGGCGGTGCCGACCCCGCTGATCGGCGACTGGAGT
GCCGACTCGGGCTACGAGCTGGGACGGCGGCTGGCCCGGCGCACGGACGTCACGGCCGTG
TTCGCCTCCAACGACCAGATGGCCCTCGGTCTGCTGCACGCCCTCCACGAAGCGGGCCGC
TCCGTCCCCGGCGACATCAGTGTCGTGGGCTACGACGACATCCCCGAGGCCGCACACTTC
CTTCCCCCGCTGACCACCGTGCGCACGGACTTCGCCGAGATCGGCACGCGCTCGCTCCGG
CTGCTCCTGGACCGTCTCGACGGCACCGAGGAACCGGCCCGGACCCGCTCGCTGGTCCCG
GTCGACCTGGTGATTCGCGCCAGCAGCGGCCCCCCGCCCACTCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000843 Transcription regulator HTH, LacI (Domain)
 [23-93]  7.79998304125571e-34 SM00354
SM00354   HTH_LACI
 [24-78]  PS50932
PS50932   HTH_LACI_2
 [26-70]  2.5e-20 PF00356
PF00356   LacI
 [26-44]  PS00356
PS00356   HTH_LACI_1
 [25-35]  8.29999581180008e-05 PR00036 [35-45]  8.29999581180008e-05 PR00036
PR00036   HTHLACI
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [22-80]  6.09999977126211e-20 SSF47413
SSF47413   Lambda_like_DNA
 [26-84]  9.8e-26 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
SignalP
 [1-20]  0.33 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Chart_00330 Chart_00330   last last