close all open/close all
first first   Chlor_00020 Chlor_00020

CDS information : Chlor_00010


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction255 / 1,358 / + [in whole cluster]
255 / 1,358 / + [in contig]
Location255..1358 [in whole cluster]
255..1358 [in contig]
TypeCDS
Length1,104 bp (367 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative prephenate dehydrogenase
Product (GenBank)PCZA363.1
Genepdh
ORF1
Gene (GenBank)
EC number1.3.1.-
Keyword
  • Hpg
Note
Note (GenBank)
  • similar to prephenate dehydrogenase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[12596194] Vancomycin assembly: nature's way. (Angew Chem Int Ed Engl. , 2003)
Related Reference
ACC
Q799B2
NITE
Balhi_00050
PmId
[20570618] Increased glycopeptide production after overexpression of shikimate pathway genes being part of the balhimycin biosynthetic gene cluster. (Metab Eng. , 2010)
ACC
Q04983
PmId
[7916685] An allosterically insensitive class of cyclohexadienyl dehydrogenase from Zymomonas mobilis. (Eur J Biochem. , 1993)
ACC
P20692
PmId
[4321765] The enzymology of prephenate dehydrogenase in Bacillus subtilis. (J Biol Chem. , 1970)
Family/Domain
FD
IPR003099

close this sectionSequence

selected fasta
>putative prephenate dehydrogenase [PCZA363.1]
MEKVLVVGTGLIGTSAALALREKDVTVYLCDIDADAVRLARELGAGQEWTGQDVDLAVIA
VPPHLVGESLADLQKQGAARAYTDVASVKVDPIADAERLGCDMTCYVPGHPLAGRERSGP
AAARADLFLGRPWALCPGPETEAGAEQLARELVSLCGAKSVTVGARQHDSAVALVSHAPH
VAASAVAASLESGDEVALGLAGQGLRDTTRIAAGDPLLWRMILSGNAQPVAGVLDRIAAD
LVAAASALRSGDLDDVTDLLRRGVDGHGRIPGKHSGPVRDFATVQVVLRDRPGELARLFN
AAGLADVNVEDVRLEHSTGLPVGVAEISVRPQDTDRLADALRFHGWHVPPVPATHQVSQH
RSQGCPR
selected fasta
>putative prephenate dehydrogenase [PCZA363.1]
ATGGAGAAGGTGCTCGTTGTCGGCACTGGACTGATCGGCACCTCCGCGGCGCTGGCACTT
CGCGAGAAGGACGTGACGGTCTATCTCTGCGACATTGACGCGGATGCCGTACGGCTGGCA
CGAGAACTCGGCGCGGGCCAGGAATGGACCGGCCAGGACGTGGACCTGGCGGTGATCGCC
GTGCCGCCGCATCTCGTGGGGGAGTCGCTGGCCGATCTGCAGAAGCAGGGTGCCGCCCGG
GCGTACACCGACGTGGCCAGCGTCAAGGTCGATCCGATCGCTGACGCGGAACGGCTTGGA
TGCGACATGACCTGCTATGTGCCGGGGCACCCGCTCGCCGGGCGGGAGCGATCCGGTCCG
GCCGCGGCACGCGCTGACCTGTTCTTGGGCCGCCCCTGGGCACTTTGTCCCGGCCCTGAA
ACGGAAGCTGGTGCCGAACAGCTGGCGCGGGAGCTGGTGTCGTTGTGCGGGGCGAAGTCC
GTCACGGTGGGCGCGCGCCAGCACGACTCGGCGGTAGCGCTGGTGTCACACGCTCCGCAC
GTGGCGGCATCGGCAGTGGCAGCGAGCCTGGAGAGCGGCGACGAGGTCGCGCTGGGCCTT
GCGGGACAAGGGCTGCGCGACACGACGCGCATCGCCGCCGGGGATCCCTTGCTGTGGCGG
ATGATTCTTTCCGGCAACGCCCAGCCGGTCGCCGGTGTGCTCGACCGGATCGCGGCCGAT
CTCGTCGCCGCGGCCTCGGCGCTGCGGTCGGGTGATCTGGATGACGTGACGGATCTGCTG
CGGCGTGGCGTCGACGGTCACGGCCGGATCCCGGGCAAGCACAGTGGACCGGTGCGCGAT
TTCGCCACGGTTCAAGTGGTTCTGCGGGACCGGCCGGGGGAACTGGCCCGGTTGTTCAAC
GCGGCCGGGCTGGCGGACGTCAACGTGGAGGACGTCCGGCTGGAGCACTCGACCGGCCTG
CCGGTCGGTGTGGCCGAGATTTCCGTGCGCCCGCAGGACACCGACCGGCTCGCCGACGCA
CTGCGGTTCCACGGCTGGCACGTTCCGCCTGTTCCTGCAACGCATCAGGTTTCCCAGCAC
CGGTCCCAGGGTTGTCCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002912 ACT domain (Domain)
 [283-342]  1.1e-05 PF01842
PF01842   ACT
IPR003099 Prephenate dehydrogenase (Domain)
 [2-278]  PS51176
PS51176   PDH_ADH
 [16-261]  1.39999999999997e-83 PF02153
PF02153   PDH
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [164-272]  1.50000306971104e-26 SSF48179
SSF48179   6DGDH_C_like
IPR016040 NAD(P)-binding domain (Domain)
 [2-169]  2.6e-22 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit
first first   Chlor_00020 Chlor_00020