close all open/close all

CDS information : Chlor_00020


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction1,562 / 3,514 / + [in whole cluster]
1,562 / 3,514 / + [in contig]
Location1562..3514 [in whole cluster]
1562..3514 [in contig]
TypeCDS
Length1,953 bp (650 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding/permease protein
Product (GenBank)PCZA363.2
GenecepM
ORF2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • similar to mdr/ABC transporter
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[12596194] Vancomycin assembly: nature's way. (Angew Chem Int Ed Engl. , 2003)
Related Reference
ACC
Q799B1
NITE
Balhi_00060
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[17823795] The ABC transporter Tba of Amycolatopsis balhimycina is required for efficient export of the glycopeptide antibiotic balhimycin. (Appl Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding/permease protein [PCZA363.2]
MDMVLRFEGVDKSENDPDPWVTTVRKGTLRRVLGYFRPHVGKVALFGLVAVLESLIVVAT
PLLLKELIDNGIEKNDLGLVIWMAALTAVLAVLAAGLTLVSGYISGKIGEGITYDLRVQA
LDHVRRLPIAFFTRTQTGVLVGRLHTELIMAQQHFTGLLMATTSLVMALVVLIELFYLSW
LVAVISLALIPLFLVPWVRVGRVIQRLSGRQMDANTGLGGLLQERFNVQGAMLSKLFGRP
NEEMAEFEDRASGIRKIGVSLSVWGRMAFVMMALMASLATALVYGVGGGLVLAGAFQVGT
LVAIATLLGRLFGPITQLSGMQELFQTVVVSFSRVFELLDLKPLIQERPDAVKLDKDVAP
DIEFENVSFRYPTADEVSLASLEHLKAKRERGEVTPDVLRDVSFHVQAGTLTALVGPSGA
GKSTITHLVSRLYDPNSGTVRVGGHDLRDLTFDSIREAVGVVSQDAYLFHDTIRENLLYA
RPTATEDELIEACKGAQIWDLIESLPLGLDTVTGDRGYRMSGGEKQRLAIARLLLKEPRI
VVLDEATAHLDSESEAAVQRALKTALRSRTSLVIAHRLSTIREADQILVIDGGGVRERGT
HDELMAKGGLYAELYHTQFADPRINEAKPEREDELDEPEPEPVAYMGFGG
selected fasta
>putative ABC transporter ATP-binding/permease protein [PCZA363.2]
ATGGATATGGTGTTGCGCTTCGAGGGGGTGGACAAGAGCGAGAACGATCCCGACCCCTGG
GTGACCACGGTCCGCAAGGGGACGCTGCGCCGGGTGCTCGGCTACTTCCGCCCGCACGTC
GGCAAGGTGGCGCTCTTCGGACTCGTCGCCGTGCTGGAGTCGCTTATCGTCGTCGCAACT
CCCTTGCTGTTGAAGGAGCTCATCGACAACGGCATCGAAAAGAACGATCTCGGCCTGGTG
ATCTGGATGGCCGCCCTGACCGCCGTGCTCGCCGTGCTCGCCGCGGGGCTGACGCTGGTG
TCCGGTTACATCTCCGGGAAGATCGGCGAGGGGATCACCTACGACCTCCGGGTTCAGGCG
CTCGACCATGTCCGGCGGCTGCCGATCGCGTTCTTCACCCGCACCCAGACCGGTGTGCTG
GTCGGTCGGCTGCACACCGAACTGATCATGGCGCAGCAGCATTTCACCGGCTTGCTGATG
GCAACCACCAGCCTGGTGATGGCGCTGGTGGTGCTGATCGAGCTGTTCTACCTTTCGTGG
CTTGTCGCCGTCATCTCGCTGGCGCTGATTCCGCTCTTCCTCGTGCCCTGGGTTCGCGTG
GGGCGGGTGATCCAGCGGCTGTCCGGACGGCAGATGGACGCGAACACCGGCCTTGGCGGA
CTGCTCCAGGAGCGGTTCAACGTGCAGGGCGCGATGCTCTCCAAGCTCTTCGGCCGTCCG
AACGAGGAGATGGCCGAGTTCGAGGACCGTGCCAGCGGGATCCGCAAGATCGGCGTGAGC
CTTTCGGTATGGGGCCGGATGGCCTTCGTCATGATGGCGCTGATGGCCTCGCTCGCCACG
GCGCTCGTCTACGGCGTCGGTGGCGGGCTCGTGCTCGCCGGGGCATTCCAGGTCGGCACG
CTGGTCGCCATCGCCACCCTGCTCGGGCGGCTGTTCGGGCCGATCACCCAGCTGTCCGGG
ATGCAGGAGCTCTTCCAGACCGTCGTGGTGAGCTTCTCCCGGGTCTTCGAGCTGCTGGAC
CTGAAGCCGTTGATCCAGGAACGCCCCGACGCGGTCAAGCTCGACAAGGACGTGGCCCCG
GACATCGAGTTCGAGAACGTGTCGTTCCGCTATCCCACCGCGGACGAGGTCTCGCTGGCG
TCGCTGGAGCACCTGAAGGCCAAGCGGGAACGCGGGGAAGTGACACCGGATGTCCTGCGC
GACGTGAGCTTCCACGTGCAGGCCGGAACGCTCACCGCGCTCGTCGGCCCCTCCGGCGCG
GGCAAGAGCACCATCACCCACCTGGTCTCCCGGCTGTACGACCCGAACTCCGGGACCGTT
CGCGTCGGCGGACACGATCTGCGGGACCTCACCTTCGACTCGATCCGCGAAGCGGTGGGT
GTGGTCAGCCAGGACGCCTACCTCTTCCACGACACGATCCGGGAGAACCTGCTCTACGCC
CGCCCGACGGCCACCGAGGACGAGCTGATCGAGGCGTGCAAGGGGGCCCAGATCTGGGAT
CTGATCGAATCCCTTCCCCTCGGGTTGGACACCGTCACGGGTGACCGCGGCTACCGCATG
TCCGGCGGGGAGAAGCAGCGGCTGGCCATCGCCCGGCTGCTGTTGAAGGAGCCGAGGATC
GTCGTGCTCGACGAAGCCACCGCGCACCTGGACTCCGAGTCGGAGGCCGCCGTCCAGCGG
GCACTCAAGACCGCGCTGCGCAGCCGTACCTCGCTGGTGATCGCTCACCGGTTGTCCACG
ATCCGCGAAGCCGACCAGATCCTCGTGATCGACGGCGGCGGGGTCCGTGAGCGTGGCACC
CACGACGAGTTGATGGCCAAGGGCGGTCTCTACGCGGAGCTCTACCACACACAGTTCGCC
GACCCACGAATCAATGAAGCCAAGCCGGAACGCGAAGACGAGCTGGACGAGCCGGAGCCA
GAGCCGGTGGCTTACATGGGTTTTGGAGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [45-314]  3e-21 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [362-617]  PS50893
PS50893   ABC_TRANSPORTER_2
 [423-548]  1.1e-23 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [408-594]  1.39999892049878e-16 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [16-343]  1.60000240695997e-64 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [520-534]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [44-327]  PS50929
PS50929   ABC_TM1F
SignalP No significant hit
TMHMM
 [41-63]  Transmembrane (i-o) [78-100]  Transmembrane (o-i) [155-177]  Transmembrane (i-o) [181-203]  Transmembrane (o-i) [263-285]  Transmembrane (i-o) [290-312]  Transmembrane (o-i)
Transmembrane 6