close all open/close all

CDS information : Chlor_00030


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction3,511 / 12,987 / + [in whole cluster]
3,511 / 12,987 / + [in contig]
Location3511..12987 [in whole cluster]
3511..12987 [in contig]
TypeCDS
Length9,477 bp (3,158 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)PCZA363.3
GenecepA
ORF3
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • similar to peptide synthetase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[10716695] Heterologous expression in Escherichia coli of the first module of the nonribosomal peptide synthetase for chloroeremomycin, a vancomycin-type glycopeptide antibiotic. (Proc Natl Acad Sci U S A. , 2000)

close this sectionPKS/NRPS Module

A1 leucine
2 beta-hydroxytyrosine(Bht)
3 asparagine
A38..427
PCP503..569
C602..891
A1058..1448
PCP1523..1589
E1631..2079
C2091..2382
A2567..2973
PCP3055..3121

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [PCZA363.3]
MTMTSAARTAPTVLDLFARHVDRTPDAVAVADGDRVLTYRELDELSGRLSGRLISRGVRG
GDRVAVMMDRSADLVVALLGVWKSGAAYVPVDAAYPAPRVAFMVADSAVSLTVCSAATRD
GVPEGIESIVITDEDASDTSVATVRPGDLAYVMYTSGSTGTPKGVAITHGTIAELAEDPG
WVMEPGEAVLMHSPHTFDASLFEVWTPLSLGARVVIAEPGSVDVRRLREAAAAGVTRVYL
TAGSFRAVAEESPESFAAFREVLTGGDVVPAHAVERVREACPGARVRNMYGPTEATMCAT
WHLLQPGDVMGPVMPIGRPLAGRRIQVLDESLRPVEPGVVGDLYLSGGLAEGYFNRAGLT
AERFVADPSAPGQRMYWTGDLAQWTADGELLFAGRADHQVKVRGFRIEPGEIEAALIALP
DVQDAVVAAIDGRLVGYVVADGDVDPALIRERLGAQLPEYMVPAAVIALDALPLTANGKV
DRAALPAPEFAANATSRAPSTDAERVLCGLFAELLGIDRAGVDDGFFELGGDSIVAMRLA
ARAAKAGLLVTPVQIFDEKTPARLAAVARAVPADRPDDAPLIALTAAEEAELAIAAPGAD
EIWPLAPLQDGLLFESTLDDQGPDIYQVQVILELTGPLDEARLRAAWDTVLRRHAELRLS
FHRLASGKTVQAVHGDVTLPWRSVDLSGADDVDAAVEALVGLEQQERFDLATAPLVRLVL
VRIAEDRHRLLVVIHHILIDGWSVAVILNEVSEAYTAGEQFPQQRGGASFRDYLAWLNRQ
DKDAARAAWRAELSGLDEPALIAPAGTATDYDYRATHLSPVLHTRLLEFAREQGLTVSTV
VHGAWAMVLARLARRTDVVFGTMVATRPAELQGVESMPGLLMSAVPVRVTLDGGQSVVDM
LTDLHNRQTALMPHQHLGLPEIQKAAGPGATFDTMLVIENYPRNYAGQYTYLRTIEGTHY
PVTLGITPADRFKIQLGYWPGQIPDAIAESLLEWFVGAIGALVADPSGLVGRVGMGTAAA
RGWAPPLVAGQPLPALVGQMAAQRPNDVALVDRDGELSYGELWERSVKFAAVLRAHGVGS
ESRVGLVVGRSAWWTVGMLGVMLAGGTFVPVDPAYPDERKEWIFRSADPMLVVCGGTTRE
TVPAQFADRLLVIDEVDLAAGSDAALPQVDPRNAAYVIYTSGSTGTPKGVVVTHAGLGNL
ALAHIDRFAVAPSSRVLQFAALGFDTIVSEVMMALLSGATLVVPPEQDLPPKATLTETLE
RWDVTHVKAPPSVLGTVDALPDRVETVVAAGELCPPGLVDRLSADQRMINAYGPTETTIC
ATVSMPLSPGQHPIPFGGPVPGVRGYLLDSFLRPLPPGVTGELYLAGIGVARGYLGRSAL
TAERFVADPFVPGERMYRTGDLAYWTDQGELVSAGRADDQVKIRGFRVEPREIEFALSGY
PRITQAAVTVRDDRLVAYVTPGDIDTQAVRDDLASRMPQYMVPAAVVALDALPLTAHGKI
DRRALPDPDFTAGTTSREPTTETERVLCELFAGVLGLARVGVDDSFFELGGDSILSMQLA
ARARRAGLTFTAADVFDGKTPERIAHLAAVESAPSEHGRSTTADGVGDVAWTPLTWMLGD
GVVGARFAQWMVVGAPSDLTEKALVAGFAALVDTHDMLRARVVNDQGGRRLVVGERGSVD
AAKLVTRVRVDGGSLDEAVEDAAREAVNRLDPLAGVMAQAVWVDAGPDQVGRLLVVAHHL
SVDGVSWRVLMSDLQAATEAVAAGRDPVLEPEGVSFRRWAGLLKEWAVAADRVGELAAWK
AILGHEEQPVGARGLTTGQAAQGDVRSRSWVVPKAETSVLMGRAPVVFHCGVNEVLLAGL
AGAVARWRGGDAVLVDVESHGRHPVDGMDLSRTVGWFTSAHPVRLDVAGIDLADVLAGGS
AAGRLLKVVKEQSRAVPGDGLGYGLLRYLNGTTGPVLAELPSPQIGFNYMGRFVTSEKSG
VRAWQPVGDIGSSLEPGMGLPHALDVNALVQDLPDGPELTLMVEWQEDLLGEAEIERLVQ
EWLDMLSGLARQADDPAAGGHTASDFDLVDLDQDEIEALEAEHAGVGGLADVLPLSPLQH
GLAFHAGYAGGVDVYTAQAVLDLTGPLDMQLLRKSVRGLLDRHANLRAGFRHAADGTAYQ
AIAGTVEVPVTLVDVTDSADPQAEAVAVEAAERARPFDLARPPLLRFMVVALGPDRHRLV
LTNHHILLDGWSTPLLLDELLTLYRNGAVPSALAPVTPYRQYLAWMRETDRDAATAAWRN
ALAGLPEPTLVAADGPAPVQVPEQMWAARDEAFAEALAARARECGVTVSTVLQAVWGMVL
ATITGRDDVVFGSVVSGRPAELPGIETMIGLFINTVPVRVRMRPQHTFTELVQRLQNEQI
ALLAHHHVGLTDIQQAAGLGQLFDTIIVYENYPTPAAAGDEAADAQPDRLRVRGVEGADA
THYPMALAVVPGTGLRLRLEHQPALFTTAQASAVLDRFVQVLEAVVADPRLPLSAVPILS
ESERQQLQARNDTALQVPSRMLPELFAAQVAATPEATAAIFEDQSLSYAELDARANQLAR
WLIEQGVGPEDLVAVMLPRSLELVIALLAATKTGGAWLPIDPDYPADRIAYMLDDAEPAL
VITTAALSASPVGEVLAARSTTMVIDDPSAAGEVAGRDRAPVTDTDRTRRLDPRHPAYLI
YTSGSTGRPKAVVITHRNLTNYLFHCGRMYPGLRGRSVMHSSIAFDLTITAMFTPLTVGG
TVHVGALEAVIGAVDSAPSIFLKATPSHLRTLDTGSRESAVSGDLLLGGEQLPVDTIVQW
RRTYPNTVVVNEYGPTEATVGCVEYRLEPGQECPPGGVVPIGTPLTNMRAFVLDSWLRLV
PPGAVGELYVSGVGVARGYLGRAGLTASRFVADPFGSGERMYRTGDLVRWNPDGQLVFAG
RVDDQVKVRGFRIEPGEIEAALVAQESVGQAVVVAHDSDVGKRLIAYVTAAGQTGVDTAA
VREGVAARLPQYMVPAAVVVLDALPLTTNGKVDRAALPDPDFNGRVVGREPVTEVERLLC
ELFAEVLGLERAGADDSFFELGGDSILSMQLAARAHRQGMAFGAREVFEQRTPAGIAAIV
ERAAAYPVAAGNAASDVALLELDQAEIDEFESEFDSDR
selected fasta
>non-ribosomal peptide synthetase [PCZA363.3]
ATGACGATGACTTCCGCAGCGCGTACCGCGCCGACGGTGCTGGATCTGTTCGCCCGGCAC
GTGGACCGGACGCCCGATGCGGTGGCCGTGGCCGACGGCGATCGGGTTCTGACGTATCGG
GAACTCGATGAGCTCTCGGGCCGGTTGTCCGGACGGTTGATCAGCCGGGGCGTCCGCGGT
GGCGACCGCGTCGCGGTCATGATGGACCGTTCGGCTGACCTGGTGGTCGCGCTGCTCGGC
GTGTGGAAGTCGGGCGCGGCGTACGTGCCGGTGGACGCCGCCTACCCCGCGCCGCGGGTC
GCGTTCATGGTGGCGGACTCGGCGGTGTCCCTGACGGTGTGCTCGGCCGCGACCCGCGAC
GGCGTACCGGAGGGAATCGAGTCGATCGTCATCACGGACGAAGACGCGAGCGACACGTCG
GTGGCCACGGTGCGCCCAGGGGACCTGGCGTACGTGATGTACACGTCCGGCTCAACGGGC
ACGCCGAAGGGCGTGGCGATTACGCACGGCACCATTGCGGAATTGGCTGAGGATCCCGGT
TGGGTGATGGAGCCCGGCGAAGCGGTGCTGATGCATTCGCCGCACACCTTCGATGCGTCC
CTGTTCGAGGTCTGGACGCCGCTGTCGTTGGGCGCTCGGGTGGTGATCGCCGAGCCGGGT
TCGGTGGACGTCCGGCGCCTGCGCGAGGCGGCCGCGGCCGGCGTGACGAGGGTGTACCTG
ACCGCGGGGAGCTTCCGCGCGGTGGCCGAGGAATCGCCGGAGTCATTCGCGGCTTTCCGT
GAGGTGCTGACCGGCGGTGACGTGGTGCCCGCGCACGCGGTGGAGCGAGTGCGGGAGGCC
TGCCCCGGGGCGCGGGTTCGGAACATGTACGGCCCGACGGAAGCGACGATGTGCGCGACG
TGGCATCTGCTGCAGCCGGGTGACGTGATGGGTCCGGTCATGCCGATCGGACGTCCGCTG
GCGGGCCGCCGGATTCAGGTGCTCGACGAGTCGCTGCGGCCGGTGGAGCCGGGTGTGGTC
GGTGACCTGTACCTGTCCGGTGGTCTGGCGGAGGGCTACTTCAACCGGGCGGGCCTGACC
GCGGAACGGTTCGTGGCGGATCCATCCGCACCCGGGCAGCGGATGTACTGGACGGGGGAC
CTGGCCCAGTGGACCGCGGACGGTGAGCTGCTGTTCGCGGGCCGGGCCGACCACCAGGTG
AAGGTCCGCGGGTTCCGGATCGAGCCCGGCGAGATCGAGGCCGCGCTGATCGCGCTGCCG
GACGTGCAGGACGCCGTGGTGGCGGCGATCGATGGACGGCTGGTCGGTTATGTGGTGGCG
GACGGGGATGTGGATCCCGCTCTCATCCGCGAGCGCCTCGGGGCGCAACTGCCGGAGTAC
ATGGTTCCGGCGGCTGTGATCGCACTGGACGCGTTGCCGCTGACCGCCAACGGCAAGGTG
GACAGGGCGGCGCTGCCCGCCCCTGAGTTCGCGGCGAACGCCACGAGCCGGGCACCCAGC
ACCGACGCGGAACGTGTCCTCTGTGGACTGTTCGCCGAGTTGCTCGGTATTGACCGAGCC
GGTGTGGACGACGGCTTCTTCGAGCTGGGCGGCGATTCGATCGTCGCGATGCGTCTTGCG
GCACGTGCGGCCAAGGCCGGGTTGCTGGTGACGCCCGTCCAGATCTTCGACGAGAAGACC
CCCGCGCGGCTGGCGGCCGTGGCGCGTGCGGTACCGGCCGACAGGCCCGACGACGCCCCC
TTGATCGCACTGACCGCGGCGGAGGAGGCCGAGCTGGCGATCGCCGCCCCGGGCGCCGAC
GAGATCTGGCCGCTGGCACCGCTGCAGGACGGGTTGCTCTTCGAGTCGACCCTCGATGAT
CAAGGGCCCGACATCTACCAGGTGCAGGTGATCCTGGAGCTGACCGGGCCGCTGGACGAG
GCCCGGCTGCGGGCCGCGTGGGACACGGTCCTGCGCCGGCACGCCGAGCTTCGGCTGAGC
TTCCATCGACTCGCGTCGGGCAAGACGGTGCAGGCCGTCCACGGGGACGTCACCCTGCCA
TGGCGGTCGGTGGATCTGTCAGGTGCCGACGATGTCGACGCGGCCGTCGAGGCACTGGTC
GGACTGGAACAGCAGGAGCGGTTCGATCTCGCCACGGCGCCGCTTGTCCGGCTGGTGCTG
GTGCGGATCGCGGAGGACCGGCACCGGCTGCTGGTCGTCATTCACCACATCCTGATCGAC
GGGTGGTCGGTGGCGGTCATTCTCAACGAGGTGTCCGAGGCGTACACGGCCGGTGAGCAG
TTCCCGCAACAGCGGGGTGGCGCCTCCTTCCGGGACTACTTGGCTTGGCTCAACCGGCAG
GACAAGGACGCGGCACGGGCGGCATGGCGGGCGGAGCTGTCCGGCCTCGACGAGCCCGCG
CTGATCGCGCCGGCGGGCACCGCGACGGACTACGACTACCGCGCCACCCACCTGTCGCCG
GTTCTGCACACCAGGCTGCTGGAGTTCGCCCGTGAGCAGGGGCTGACGGTGAGCACGGTG
GTGCACGGTGCCTGGGCGATGGTGCTGGCGAGGCTTGCCCGGCGAACCGACGTGGTGTTC
GGCACCATGGTCGCGACCCGTCCCGCGGAACTCCAGGGCGTGGAGTCGATGCCGGGCCTG
CTGATGAGCGCGGTGCCGGTCCGAGTGACACTGGACGGCGGGCAGTCGGTCGTGGACATG
CTCACCGATCTGCACAACCGGCAGACGGCCCTCATGCCGCACCAGCATCTGGGACTACCG
GAGATCCAGAAGGCGGCCGGGCCTGGCGCGACGTTCGACACGATGCTGGTGATCGAGAAC
TACCCGCGCAACTACGCCGGTCAGTACACGTATCTGCGCACGATCGAGGGGACCCACTAT
CCGGTGACCCTCGGCATCACCCCGGCGGATCGGTTCAAGATCCAGCTCGGCTACTGGCCG
GGGCAGATCCCGGACGCCATCGCCGAGTCGCTGCTGGAGTGGTTCGTCGGCGCCATCGGC
GCGCTGGTCGCCGATCCGTCCGGCCTGGTGGGGCGGGTCGGTATGGGCACGGCCGCGGCA
CGCGGCTGGGCCCCGCCATTGGTGGCGGGGCAGCCGCTTCCCGCGCTGGTAGGACAGATG
GCGGCGCAGCGGCCCAACGACGTGGCGTTGGTGGATCGCGATGGTGAGTTGTCGTATGGG
GAGCTGTGGGAACGGTCGGTGAAGTTCGCGGCCGTGTTGCGGGCCCACGGGGTTGGCTCC
GAGAGCCGGGTCGGCCTGGTGGTGGGGCGGTCGGCCTGGTGGACGGTCGGCATGTTGGGC
GTAATGTTGGCGGGCGGCACGTTCGTGCCGGTCGACCCGGCATATCCGGACGAGCGCAAG
GAATGGATTTTCCGAAGCGCGGATCCGATGTTGGTGGTGTGCGGGGGTACGACGCGCGAG
ACGGTGCCCGCGCAGTTCGCGGACCGGTTGTTGGTGATCGATGAGGTGGACCTGGCAGCG
GGCTCGGATGCTGCGCTGCCACAAGTGGATCCGCGTAATGCCGCGTATGTGATCTACACG
TCGGGGTCGACGGGAACTCCGAAGGGAGTCGTCGTCACCCATGCGGGGCTTGGGAACCTG
GCGTTGGCGCACATCGACCGGTTCGCTGTGGCCCCGTCGTCCCGGGTTCTGCAGTTCGCG
GCGCTCGGCTTCGACACCATCGTGTCCGAGGTGATGATGGCGTTGCTGTCGGGAGCGACG
CTGGTGGTGCCGCCGGAGCAGGATTTGCCGCCGAAGGCGACGCTGACCGAGACCTTGGAG
CGGTGGGACGTCACGCACGTGAAGGCCCCGCCGTCGGTGCTGGGCACCGTCGACGCGTTG
CCCGACAGGGTGGAGACGGTGGTGGCGGCGGGAGAGCTCTGCCCGCCGGGCCTGGTGGAC
CGCCTGTCGGCGGACCAGCGGATGATCAACGCCTACGGGCCGACCGAGACCACGATCTGT
GCGACGGTGAGCATGCCGTTGTCGCCGGGCCAGCATCCGATCCCGTTCGGCGGGCCGGTC
CCGGGCGTTCGCGGTTATCTGCTGGACTCGTTCCTGCGTCCGTTGCCGCCCGGCGTCACC
GGTGAGCTGTATCTGGCCGGGATCGGGGTGGCCCGCGGCTATCTGGGCCGTTCGGCGCTG
ACAGCCGAGCGGTTCGTCGCCGATCCGTTCGTCCCCGGTGAGCGGATGTACCGGACCGGT
GACCTGGCGTACTGGACCGACCAGGGTGAGCTGGTGTCCGCCGGGCGCGCCGACGACCAG
GTCAAGATCCGTGGATTCCGGGTCGAACCCCGCGAGATCGAGTTCGCCCTGTCCGGCTAC
CCGCGGATCACCCAAGCCGCGGTGACCGTCCGCGACGACCGCCTGGTGGCCTACGTGACA
CCAGGCGACATCGACACCCAAGCGGTGCGGGACGATCTCGCGTCCCGGATGCCCCAGTAC
ATGGTGCCCGCGGCGGTGGTGGCGCTGGACGCCCTGCCGCTGACGGCGCACGGGAAGATC
GATCGACGCGCGCTGCCTGACCCCGATTTCACCGCCGGGACCACCTCCAGGGAGCCGACC
ACCGAGACCGAGCGGGTGTTGTGCGAGTTGTTCGCCGGCGTGCTCGGTCTGGCACGGGTC
GGCGTGGACGACAGTTTCTTCGAGCTGGGCGGGGACTCCATCCTCTCGATGCAGCTGGCT
GCGCGGGCGCGGCGGGCAGGACTGACGTTCACCGCGGCGGACGTCTTCGACGGGAAGACG
CCCGAGCGGATCGCGCACCTGGCAGCGGTGGAATCGGCGCCGTCGGAGCATGGTCGTTCC
ACGACGGCTGATGGTGTCGGTGATGTCGCGTGGACGCCGTTGACGTGGATGTTGGGCGAC
GGCGTTGTGGGAGCCAGGTTCGCGCAGTGGATGGTCGTGGGTGCGCCTTCGGATTTGACG
GAGAAGGCGTTGGTCGCGGGGTTTGCGGCCCTGGTGGATACGCATGACATGTTGCGGGCG
CGTGTCGTCAACGATCAGGGCGGCCGGCGCTTGGTGGTGGGTGAGCGTGGGTCTGTGGAT
GCGGCCAAGTTGGTCACCCGCGTGCGGGTTGACGGTGGCTCGTTGGACGAGGCTGTGGAG
GACGCGGCGCGAGAGGCCGTGAACCGGTTGGACCCGCTGGCGGGCGTGATGGCCCAGGCG
GTGTGGGTGGACGCCGGACCGGATCAGGTGGGCCGGTTGCTGGTGGTGGCGCATCACTTG
TCGGTCGACGGCGTGTCGTGGCGGGTTTTGATGTCGGATCTCCAGGCGGCCACCGAAGCG
GTGGCGGCGGGGCGGGATCCGGTGCTGGAGCCGGAGGGCGTGTCGTTCAGGCGGTGGGCG
GGCCTGCTGAAGGAGTGGGCGGTCGCCGCGGACCGGGTCGGCGAGTTGGCGGCGTGGAAG
GCGATTCTCGGTCACGAGGAGCAGCCAGTCGGTGCACGTGGGCTGACCACAGGCCAGGCC
GCGCAAGGCGATGTGCGCTCACGCTCGTGGGTGGTGCCGAAGGCCGAGACGTCGGTGTTG
ATGGGGCGGGCTCCGGTGGTGTTCCACTGCGGGGTGAACGAGGTTCTGCTCGCCGGGCTG
GCCGGAGCGGTGGCCCGGTGGCGCGGCGGCGACGCGGTGTTGGTGGACGTGGAAAGCCAC
GGCCGTCATCCGGTCGACGGGATGGACCTGTCCCGGACCGTTGGCTGGTTCACCAGCGCA
CATCCGGTACGGCTCGACGTGGCGGGGATCGACTTGGCGGACGTGCTCGCCGGTGGTTCG
GCGGCCGGGCGGTTGCTGAAGGTGGTCAAGGAACAGTCGCGGGCCGTGCCCGGCGACGGG
CTCGGATATGGACTGTTGCGTTATCTCAACGGCACGACCGGGCCGGTTCTGGCTGAACTG
CCGTCGCCGCAGATCGGGTTCAACTACATGGGCCGGTTCGTCACCAGTGAGAAGAGTGGT
GTGCGGGCGTGGCAGCCGGTCGGTGACATCGGTAGCTCGCTGGAACCCGGCATGGGCCTG
CCGCACGCGCTCGACGTCAACGCGCTCGTCCAGGATTTGCCGGACGGCCCTGAACTGACG
CTCATGGTCGAGTGGCAGGAGGACCTGCTCGGCGAGGCCGAGATCGAACGACTGGTCCAG
GAATGGCTGGACATGTTGTCCGGGCTGGCCCGTCAGGCGGACGATCCCGCCGCGGGCGGA
CACACCGCGTCCGACTTCGATCTCGTCGACCTTGACCAGGACGAGATCGAGGCTCTCGAG
GCCGAACACGCGGGTGTCGGTGGGCTGGCCGATGTGTTGCCGTTGTCGCCGCTGCAGCAC
GGGCTGGCGTTCCACGCCGGCTACGCGGGTGGCGTCGATGTCTACACCGCACAGGCGGTG
CTGGATCTGACCGGTCCGCTGGACATGCAGCTGCTGCGGAAGTCAGTGCGCGGGCTGCTG
GATCGGCACGCGAATCTGCGTGCCGGATTCCGGCACGCCGCCGACGGAACCGCCTACCAG
GCGATCGCCGGCACCGTGGAGGTGCCAGTGACCCTGGTGGACGTGACGGACTCGGCAGAT
CCGCAGGCCGAAGCGGTTGCGGTGGAGGCGGCCGAACGGGCACGGCCGTTTGACCTGGCC
CGGCCTCCGCTGCTGCGGTTCATGGTGGTGGCGCTGGGCCCGGACCGGCATCGGCTGGTG
CTGACCAACCATCACATCTTGCTCGACGGCTGGTCGACGCCGCTGCTGTTGGACGAACTG
CTCACGCTTTACCGCAACGGAGCAGTCCCGTCCGCGCTGGCGCCGGTCACCCCGTATCGG
CAGTACCTGGCTTGGATGAGGGAAACCGATCGAGACGCGGCCACCGCCGCATGGCGTAAC
GCCTTGGCGGGCTTGCCAGAGCCGACCTTGGTCGCCGCGGACGGGCCGGCACCGGTCCAG
GTGCCTGAACAGATGTGGGCCGCACGGGACGAGGCGTTCGCCGAGGCATTGGCAGCGCGG
GCACGCGAGTGCGGTGTCACGGTCAGCACGGTGCTGCAGGCCGTGTGGGGCATGGTGTTG
GCGACGATCACCGGACGCGACGATGTGGTGTTCGGATCGGTGGTGTCCGGGCGTCCGGCC
GAGCTGCCAGGCATCGAGACCATGATCGGTTTGTTCATCAACACCGTCCCGGTCCGGGTC
CGGATGCGGCCGCAGCACACATTCACCGAGCTGGTGCAGCGACTGCAGAACGAGCAGATC
GCGTTGCTGGCACACCACCACGTCGGGCTCACCGACATTCAGCAGGCCGCCGGGCTTGGC
CAGCTGTTCGACACGATCATCGTCTACGAGAACTACCCCACACCGGCCGCGGCCGGCGAC
GAAGCCGCTGATGCGCAACCGGATCGGTTGCGTGTGCGGGGTGTGGAAGGCGCCGACGCC
ACCCACTACCCGATGGCGCTGGCGGTCGTCCCAGGCACCGGCCTGCGGCTGCGGCTGGAG
CACCAGCCCGCGCTGTTCACCACCGCCCAGGCCAGTGCCGTGCTGGATCGGTTCGTGCAG
GTGCTCGAAGCCGTGGTCGCTGATCCGCGGTTGCCGCTGTCGGCGGTGCCGATCTTGTCC
GAATCCGAACGGCAACAACTGCAGGCACGCAATGACACCGCGCTTCAGGTGCCGTCCCGG
ATGCTGCCGGAGCTGTTCGCCGCGCAGGTCGCCGCCACCCCGGAGGCGACCGCGGCGATC
TTCGAGGACCAGTCGCTGTCCTACGCCGAACTCGACGCACGCGCCAACCAGCTGGCGCGC
TGGCTCATCGAGCAGGGTGTCGGGCCCGAAGACCTGGTCGCGGTGATGCTGCCCCGGTCG
CTGGAACTGGTCATCGCGTTGCTGGCGGCCACCAAGACCGGCGGCGCCTGGCTGCCGATC
GATCCGGACTATCCGGCCGACCGCATCGCCTACATGCTCGACGACGCCGAACCAGCGCTG
GTGATCACCACCGCGGCGCTGTCGGCATCGCCGGTCGGTGAAGTGCTGGCCGCCCGGTCG
ACGACGATGGTGATCGATGATCCCTCGGCCGCGGGCGAGGTAGCCGGTCGGGATCGCGCG
CCGGTCACCGACACCGACCGCACTCGACGGCTGGATCCGCGCCATCCGGCGTACCTCATC
TACACCTCGGGCTCCACCGGTCGCCCCAAGGCCGTCGTCATCACCCATCGGAATCTGACG
AACTACCTGTTCCACTGCGGGCGGATGTACCCAGGTCTGCGGGGACGGTCGGTGATGCAT
TCGTCGATCGCGTTCGATTTGACGATCACCGCGATGTTCACTCCGCTCACCGTGGGCGGA
ACGGTTCACGTCGGCGCGCTGGAAGCAGTGATCGGTGCGGTGGACAGTGCCCCGTCGATA
TTCCTCAAGGCCACGCCGAGCCATTTGAGGACCTTGGACACCGGTTCTCGGGAAAGCGCC
GTTTCGGGCGATCTTCTGCTCGGCGGCGAGCAGTTGCCCGTCGACACGATCGTTCAGTGG
CGTCGCACGTACCCGAATACTGTCGTGGTCAATGAGTACGGGCCGACCGAGGCAACGGTC
GGGTGTGTCGAATATCGACTGGAACCTGGACAGGAATGTCCGCCGGGCGGTGTGGTGCCG
ATTGGTACTCCGCTGACGAATATGCGGGCTTTTGTGCTGGATTCGTGGTTGCGATTGGTG
CCGCCGGGTGCGGTGGGCGAGTTGTATGTGTCAGGTGTGGGTGTGGCGCGGGGATATCTG
GGCCGGGCGGGATTGACCGCGTCGCGATTCGTGGCCGATCCGTTCGGTTCCGGTGAGCGG
ATGTACCGGACCGGGGACTTGGTGCGGTGGAACCCGGACGGGCAGTTGGTGTTCGCCGGT
CGTGTCGATGATCAGGTGAAGGTGCGGGGTTTCCGGATCGAGCCTGGTGAGATCGAAGCG
GCCTTGGTGGCGCAGGAGTCGGTGGGCCAGGCGGTCGTGGTGGCCCATGACAGTGATGTC
GGCAAACGGCTGATCGCGTACGTGACCGCTGCCGGGCAGACCGGAGTGGACACGGCCGCT
GTGCGCGAGGGTGTGGCCGCCCGGTTGCCGCAGTACATGGTGCCTGCGGCGGTGGTGGTG
CTCGATGCGCTGCCGTTGACGACGAACGGCAAGGTGGACCGGGCGGCGCTGCCGGATCCC
GACTTCAACGGACGCGTCGTGGGCCGGGAGCCGGTCACCGAGGTCGAGCGGCTGTTGTGT
GAGCTCTTCGCCGAGGTGCTTGGCCTGGAGCGGGCCGGCGCGGACGACAGTTTCTTCGAA
CTGGGTGGGGATTCGATCCTTTCGATGCAGCTGGCGGCGCGGGCCCACCGTCAGGGAATG
GCCTTCGGCGCGCGCGAGGTGTTCGAGCAGAGGACACCCGCGGGGATCGCGGCGATCGTG
GAGCGGGCAGCGGCATATCCCGTGGCGGCGGGTAATGCCGCGTCCGACGTCGCCCTCCTC
GAGCTCGATCAAGCCGAGATCGACGAATTCGAGTCCGAATTCGACAGCGACCGTTGA
[1] A38..427
[1] leucine198..298
[1] PCP503..569
[2] C602..891
[2] A1058..1448
[2] beta-hydroxytyrosine(Bht)1225..1320
[2] PCP1523..1589
[2] E1631..2079
[3] C2091..2382
[3] A2567..2973
[3] asparagine2746..2841
[3] PCP3055..3121
[1] A112..1281
[1] leucine592..894
[1] PCP1507..1707
[2] C1804..2673
[2] A3172..4344
[2] beta-hydroxytyrosine(Bht)3673..3960
[2] PCP4567..4767
[2] E4891..6237
[3] C6271..7146
[3] A7699..8919
[3] asparagine8236..8523
[3] PCP9163..9363

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [38-427]  1.10000000000001e-103 PF00501 [1058-1448]  2.39999999999997e-108 PF00501 [2567-2973]  2.59999999999995e-110 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [602-891]  3.89999999999997e-59 PF00668 [1631-1907]  5.90000000000001e-30 PF00668 [2091-2382]  1.60000000000002e-66 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [528-543]  PS00012 [1548-1563]  PS00012 [3080-3095]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [503-569]  PS50075 [1523-1589]  PS50075 [3055-3121]  PS50075
PS50075   ACP_DOMAIN
 [506-566]  7.5e-10 PF00550 [1526-1586]  3.1e-11 PF00550 [3058-3118]  5e-11 PF00550
PF00550   PP-binding
 [496-570]  6.69999687625999e-16 SSF47336 [1516-1590]  5.29999657550189e-17 SSF47336 [3048-3122]  1.29999924468179e-18 SSF47336
SSF47336   ACP_like
 [492-570]  3.79999999999991e-71 G3DSA:1.10.1200.10 [1513-1588]  3.79999999999991e-71 G3DSA:1.10.1200.10 [3049-3123]  3.79999999999991e-71 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1922-2079]  4.2e-37 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [38-427]  2.30000000000004e-121 TIGR01733 [1058-1448]  2.70000000000002e-120 TIGR01733 [2567-2973]  6.10000000000004e-125 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [504-572]  7.09999884211141e-07 SM00823 [1524-1592]  1.89999859865864e-10 SM00823 [3056-3124]  7.70000171387738e-07 SM00823
SM00823   PKS_PP
IPR020845 AMP-binding, conserved site (Conserved_site)
 [152-163]  PS00455 [1177-1188]  PS00455 [2699-2710]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit