close all open/close all

CDS information : Chlor_00040


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction13,162 / 25,395 / + [in whole cluster]
13,162 / 25,395 / + [in contig]
Location13162..25395 [in whole cluster]
13162..25395 [in contig]
TypeCDS
Length12,234 bp (4,077 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)PCZA363.4
GenecepB
ORF4
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
Related Reference
ACC
Q939Z0
NITE
Balhi_00080
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)

close this sectionPKS/NRPS Module

A4 L-4-hydroxyphenylglycine(Hpg)
5 L-4-hydroxyphenylglycine(Hpg)
6 beta-hydroxytyrosine(Bht)
C7..301
A482..879
PCP957..1023
E1063..1501
C1510..1801
A1982..2376
PCP2459..2525
E2563..3012
C3023..3314
A3499..3887
PCP3974..4040

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [PCZA363.4]
MTQSRIEEIWPLSPLQAGLLFHAVYDGEGPDVYIGHWILDLDGPVDAARLRAAWETLLTR
HAPLRACFRQRKSGETVQIIARQVELPWREVDLSHLDDPEQAVRELAEQDRTTRFDLTQA
PLLRLTLIRLDDDKFRLVVTCHHTIMDGWSLPIVIDELSMLYPAGDAPAALPEVTSYREY
LAWLSRRDKERALSAWAAELRGVEEPTLVAPADPGRAPAEPESVEVDLPENLTRSLAELA
RGHGLTLNTVVQGAWALVLAQLSGRTDVVFGAAVSARPPDLPGVEGMVGLFLNTVPVRVR
LRGSMPVIELLAELQKRQSALIPDQFVGLADIQQVAGPAAVFDTLLVFEKFHHGPAGSDS
AQTFGIQVNQGRVAAHYPLTLVAVPGESMYVKLDYLTDLFDQDTALAIVERFTGVLRQLT
DAGDLTVADVDVTSAAERALVVDEWGAASQATPSMLALDLFGSQVKDRRDEVAVVDGDRA
MSYGELAEHAERLAGYLNGRGVRRGDRVAVVLDRSLDLIATLLAVWQAGAAYVPVDPAYP
VERMKFMLADSEPAAVVCAEAYRDAVLDVGLDPISLDDPQTRQAVAAAARISVGTKANDL
AYVMYTSGSTGTPKGVAVSHGNVAALVGEPGWGVGPDDAVLMHASHAFDISLFEMWVPLL
SGARLVLAGSGAVDGEALAGYVAGGVTAAHLTAGAFRVLADESPESVVGLREVLTGGDAV
PLAAVERVRRTCPDVRVRHLYGPTEATLCATWWLLEPGDETGSVLPIGRPLAGRRVYVLD
AFLRPVPPGVAGELYIAGAGVAQGYLGRSALTAERFVADPFVAAGRMYRTGDLAYWTHQG
ALAFAGRADDQVKIRGYRVEPGEIEVVLAGLPGVGQAVVSVRDEHLIGYVVAEAGQAIDP
ARLREQLAETLPEFMVPAAVLVLDELPLTVNGKVDRRALPEPDFASKSAGREPVTEAERV
LCGVFAEVLGLDRVGIEDSFFELGGDSISSMQVAARARREGISLTPRQVFEHRTPERLAA
LAQEASTTPRAEVVTGVGEIPWTPVMRALGDDAMRPGFVQVRVVVTPAGLNLDALVSALQ
AVLDGHDLLRARVEPDGRLIVPERGAVDATGLVTRVAVGTGDLDEIAEREVRTATGTLNP
SAGIMARLVWIDAGDAEPGRLAFVAHHLSVDAVSWGILLPDLQTAYDEVISGGTPALEPP
TTSYRQWARRLTEQALSESTVAELDQWVAVLDGANPPLEQDTGQHTGQSHSWSTRLSGTE
VRNLVAHLPGAFHCGIQDVLLAGLAGAVARVRGTGAGLLVDVEGHGREAADGEDLLRTVG
WFTSVHPVRLDLSDVDLAAAAAGNAPAGQLLKAVKEQIRAVPGDGSGYGLLRHLNPDTGA
RLAELPSAQIGFNYLGRTVLAAQNTAWQQPVAEGPLGGGPDMVLAHAVEVSAELLDTPAG
PRLGLAIDTRDFDLATVERLGEAWLEMLTGLAAMAGNPGAGGHTPSDFDLVDLTQRDVTE
LEAAAPGLTDIWPLSPLQEGMLFERAFDEDGVDVYQTQRILDLDGPLDAQRLRTAWNQVV
ARHESLRTSFHQLGSGETVQVVAREADIPWRVADLSHLDEAEAAAEVERLLAQDQAERFD
VATAPLLRLLLIRLGADKHKLVMTSHHLLVDGWSTPLIVGEMSAGYAGGPSASKSPSYKD
YLAWLSRQDEETTRSAWRSELAGCDEPTLVDADAGKTLVMPDNRSELLSEATTRTLADFA
RGHGLTLSTVVLGAWALVLARLAGRTDVVFGSVVSGRPADVPDVERMVGMFINTVPARVR
LDGRQPVVEMLKDLQGRQSALTEHQYMGLPEIQKVAGTGAIFDTIVMIENYPHTAAGLGD
DGGVVISSVATRTGTSYPLTMNVSLGERLRVNVSYRPDRIDDETATEVARQVVRVLEQVV
AQPLLPVGRLGVTSEPARASVVERWNSTGEAANRTSVLELFRQQADASPDAVAVMDAART
LSYADLDRESDRLAGYLAAMGVRRGDRVGVVMERGTDLFVALLAVWKAGAAQVPVNVDYP
AERIERMLADAGASVAVCLEATRKAVPDGVEPVVMDVPAIDGVRHEAPQVTVGAHDLAYV
MYTSGSTGVPKGVAVPHGSVAALASDPGWSQGPDDCVLLHASHAFDASLVEIWVPLVNGS
RVMVAEPGAVDAERLREAISRGVTTVHLTAGAFRAVAEESPDSFTGLREILTGGDAVPLA
SVVRMRRACPDVRVRQLYGPTEITLCATWHVIEPGAETGDTLPIGRPLAGRQAYVLDAFL
QPVAPNVTGELYIAGAGLAHGYLGNNGSTSERFIANPFASGERMYRTGDLARWTDQGELL
FAGRADSQVKIRGYRVEPGEIEVALTEVPHVAQAVVVAREDHPGDKRLIAYVTAEEGPAL
AADAVREHLAARMPEFMVPAVVLVLDSFPLTLNGKIDRAALPAPEFTGKAAGREPRTETE
RVLCDLFAEILGLDRVGADDSFFELGGDSILSMRLAARARRENFVFGAKQVFEQKTPAGI
AAVAERGGQARVEDAEGVGEVPWTPVVRAMLERDPIGLTRGAMAQWVTVDVPDDLSVTAL
AAGLGAVIDTHDMLRSRIVDTEGAEPRLVVAGRGTVDASTLVERVEAGADDVDEIADRCA
NDAAARLDPVAGVMVRAVWVDAGPGRAGRLVVAAHHLVVDVVSWRTLLPDLQAACEAVAA
GLRPALDPPDVSFRRWARTLADEAAIRTAELATWTDILDGARSRLGELDPKRDTVSTAGR
KSWTVPQKHAGVLVEKVTSAFHCGVHEVLLATLAGAVASWRGGTDVVVDVEGHGRQPIGE
MDLSRTLGWFTDVHPLRLDVTGVDTAEAIAGGGAAGRLLKQVKENVRAVPDGGLGYGMLR
YLNAETGPVLAALPKAEIGFNYLGRFSSRPDGEAQPWQIKGIVGGAAEQDTPLRHVVEID
AVVLDGADGPEFTLTVTWAGRIVGDAEAESFANAWLDMLSGLAAHVEAGGAGGHTPSDFP
LTTLTQREVAEIEAAVPNLLDIWPLSPLQEGLLFHAADEGGPDVYASMRTLVLDGPLDVD
RFRASWQTLLDRHAALRASFHQVESGTAVQAIAREVTLPWRETDLSHLPEDEAVAEFDRL
AAELLAERFDPTQAPLLRLHLVRFGEREHRLIFTSHHIAADGWSLPLIGVDVLAAYEAGG
DGRTLPAATSYRDYLAWIARQDKTAAREAWRTELAGLEEATNVVPPESIRTPLVPERVRF
ELGDEPSRRLVEFARRHGVTPNTLFQGVWALHLARLTGRQDVVFGAAVAGRPPEIPGVES
SVGLFMNMLPVRARLTGAQPVVDMLKDLQERQIALMSHQHIGLSEIKQFAGPGAAFDTIV
VFENYPPPPPRFDGPDALVMRPAGTPNDTGHYPLSIRASVAAGPVQGEFIYRPDVVDRAE
AEEMVAALLRALEQVLADPRMPVGQVGLIGPQQRRLVVDEWNQTDAPLAAETLPVLFREQ
AWQSPDAVAVQDGVRSLSFSGLLDEVEALARLLVGLGVRREARVGVLVERSVELAVTLMG
VSFAGGVFVPVDPDYPSERIEFMLANSAPEVLVCTKTTRAVVPAQFTGTVLVLDELPAAD
PGVELPDVAPEDAAYVIYTSGSTGVPKGVLVTHSGLVNLGYAHIERMAVTSSSRVLQLSA
IGFDAIVSELYMALLAGATLVLPDSANMPPRVTLGDAIRKAGITHLTVSPSVLASEDDLP
DTLQTVLTGGEALPAALVDRWSPGRRVIQAYGPTETTICSTMSAPLSPGHDQVPLGGPIY
NVRHYVLDAFLQPVPPGVVGELYITGVGLARGYLGRPGLTAERFVASPFAPGERMYRSGD
LFRWTREGQLMFAGRVDAQVKVRGYRVEPAEIEAVLIEHPGVAQVAVAVRRDGPGDKQLV
AYVVPSADAAGENGTLTSALRELAAERLPEYMMPAAFVSLEKMPLTPNGKLDHKALQAPD
FAAMSTKRDPSTPMEARLCELFADVLGLEQVGVDDSFFELGGDSITSMQLSARARREGLE
LTPWQVFDEKTPERLAAMVKEIQAEEETAAVPKPAAGTLLALSADQMNQLEAGLAGE
selected fasta
>non-ribosomal peptide synthetase [PCZA363.4]
ATGACCCAGTCGCGGATCGAGGAAATCTGGCCGCTGTCGCCACTGCAGGCCGGTTTGCTC
TTCCACGCGGTTTACGACGGCGAAGGGCCCGACGTCTACATCGGTCATTGGATCCTGGAC
CTGGACGGACCGGTGGACGCGGCCAGGCTGCGCGCGGCTTGGGAAACGCTGCTGACCCGG
CACGCCCCGCTCCGGGCTTGTTTCCGGCAGCGCAAATCGGGCGAGACGGTGCAGATCATC
GCCAGGCAGGTGGAACTGCCGTGGCGGGAGGTCGACCTTTCCCACCTCGACGACCCCGAG
CAGGCCGTGCGGGAGCTGGCCGAGCAGGATCGGACGACGAGGTTCGACCTCACGCAGGCG
CCGTTGCTGCGGCTGACCTTGATCCGTCTCGACGACGACAAGTTCCGCCTGGTGGTGACC
TGCCATCACACGATCATGGACGGCTGGTCGCTGCCCATCGTGATCGACGAGCTGTCGATG
CTGTACCCGGCAGGCGATGCCCCGGCGGCCCTGCCGGAAGTGACGTCATACCGGGAATAC
CTCGCGTGGCTGAGCCGGCGGGACAAGGAACGGGCGCTGTCGGCATGGGCCGCGGAGCTG
CGTGGTGTCGAGGAACCGACGCTGGTGGCGCCCGCCGATCCGGGGCGGGCGCCCGCCGAG
CCGGAGAGCGTCGAGGTCGACCTGCCGGAGAACCTCACGCGATCGCTGGCCGAGCTGGCC
CGTGGCCATGGGTTGACGCTGAACACGGTGGTGCAGGGCGCGTGGGCGTTGGTGCTGGCG
CAGCTGTCCGGCCGGACGGACGTGGTGTTCGGCGCGGCGGTATCGGCGCGCCCGCCGGAT
TTGCCCGGCGTGGAGGGAATGGTGGGGCTGTTCCTCAACACCGTTCCCGTGCGCGTGCGG
TTGCGTGGCTCGATGCCGGTCATCGAACTGCTGGCGGAGCTGCAGAAACGGCAGTCGGCG
CTGATCCCCGACCAGTTCGTGGGTCTGGCGGACATCCAGCAGGTGGCCGGCCCTGCCGCG
GTCTTCGACACGCTGCTCGTCTTCGAGAAGTTCCACCATGGGCCCGCCGGATCGGACTCC
GCGCAAACCTTTGGCATTCAAGTAAATCAGGGCCGGGTGGCCGCCCATTATCCACTGACG
CTTGTCGCTGTCCCCGGCGAGTCGATGTACGTCAAGCTCGACTATCTGACGGATCTGTTC
GATCAGGACACCGCGCTCGCCATCGTCGAGCGATTCACGGGTGTGCTGCGTCAGCTGACG
GACGCGGGCGACCTCACGGTGGCCGATGTCGATGTGACGAGTGCGGCCGAGCGTGCCTTG
GTGGTCGACGAATGGGGTGCTGCATCCCAGGCGACGCCCAGCATGCTGGCACTGGATCTG
TTCGGCAGCCAGGTGAAGGACCGTCGCGACGAGGTAGCGGTCGTCGATGGCGATCGGGCG
ATGTCGTACGGAGAACTCGCTGAGCACGCGGAGCGGCTCGCCGGCTATCTGAACGGCAGG
GGAGTTCGGCGCGGGGACCGGGTGGCCGTGGTGCTGGACCGGTCACTCGACCTGATCGCG
ACATTGCTCGCGGTGTGGCAGGCGGGCGCGGCGTACGTGCCGGTGGATCCCGCCTATCCG
GTGGAACGCATGAAGTTCATGCTGGCGGATTCCGAACCCGCGGCGGTTGTGTGCGCGGAA
GCGTACCGGGATGCCGTGCTGGACGTCGGGCTCGATCCGATCAGCCTCGACGATCCACAG
ACGCGGCAGGCGGTGGCTGCGGCCGCGCGTATTTCGGTTGGTACGAAAGCCAATGACCTC
GCATACGTGATGTACACCTCGGGGTCGACGGGAACGCCGAAGGGCGTCGCGGTGTCGCAC
GGCAATGTCGCGGCGCTGGTCGGCGAACCGGGATGGGGAGTGGGCCCCGACGACGCCGTG
TTGATGCATGCCTCGCACGCGTTCGACATCTCGCTGTTCGAGATGTGGGTGCCGCTGCTG
TCGGGCGCCCGGCTGGTGCTGGCCGGATCCGGTGCGGTGGACGGCGAAGCACTTGCCGGC
TATGTCGCCGGTGGCGTCACGGCCGCCCACCTGACCGCAGGGGCCTTCCGGGTGCTGGCC
GACGAGTCACCGGAGTCGGTCGTCGGTCTGCGCGAAGTGCTGACCGGTGGGGACGCGGTG
CCGTTGGCGGCGGTGGAACGGGTCCGGCGGACGTGCCCGGACGTGCGGGTGCGGCACCTC
TATGGCCCGACGGAGGCCACGCTGTGCGCGACGTGGTGGCTGCTCGAACCCGGTGACGAG
ACGGGATCGGTGCTGCCGATCGGACGTCCGCTCGCGGGACGGCGTGTCTACGTCCTCGAT
GCGTTCCTGCGGCCCGTGCCTCCGGGTGTGGCCGGCGAGCTGTACATCGCCGGAGCCGGT
GTGGCGCAAGGCTATCTGGGTCGTTCGGCGTTGACGGCCGAGCGTTTCGTCGCCGATCCG
TTCGTCGCGGCTGGGCGGATGTACCGAACCGGGGACCTGGCGTACTGGACGCACCAGGGT
GCGCTGGCGTTCGCCGGCCGGGCCGACGACCAGGTGAAGATCCGTGGATACCGGGTGGAA
CCCGGCGAGATCGAGGTGGTCCTCGCCGGCCTGCCAGGTGTCGGCCAGGCCGTGGTGTCC
GTACGGGACGAGCACCTGATCGGTTACGTGGTCGCCGAAGCGGGGCAGGCCATCGACCCC
GCGCGGCTGCGCGAACAGCTCGCTGAGACGCTGCCCGAGTTCATGGTTCCGGCCGCGGTG
CTGGTGCTGGACGAATTGCCGTTGACGGTCAACGGAAAGGTGGACCGGCGGGCACTGCCC
GAACCGGACTTCGCGTCGAAGTCGGCGGGCCGGGAGCCGGTCACCGAGGCCGAACGAGTC
CTGTGTGGAGTGTTCGCCGAAGTCCTTGGCCTTGACCGGGTTGGCATCGAGGACAGTTTC
TTCGAGCTGGGCGGCGACTCGATCTCGTCGATGCAGGTCGCCGCTCGTGCGCGGCGCGAA
GGCATCTCGCTGACCCCGAGGCAGGTGTTCGAGCACCGGACCCCTGAGCGCCTCGCGGCA
CTGGCACAAGAGGCCAGCACGACGCCACGCGCCGAGGTCGTCACAGGCGTCGGGGAGATC
CCGTGGACGCCGGTGATGCGTGCGCTCGGGGACGACGCGATGCGCCCTGGCTTCGTGCAG
GTGAGGGTCGTCGTCACGCCGGCGGGCTTGAACCTGGACGCGTTGGTGAGCGCCCTGCAA
GCGGTGCTGGATGGGCATGATCTGCTGCGGGCACGGGTGGAGCCGGACGGACGGCTGATC
GTGCCCGAGCGCGGTGCGGTGGACGCGACCGGCCTGGTCACGCGGGTGGCCGTCGGGACA
GGGGATCTCGACGAGATCGCCGAGCGCGAGGTCAGGACGGCGACGGGAACGCTGAACCCG
TCGGCGGGAATCATGGCGCGGCTCGTGTGGATCGACGCCGGGGACGCCGAGCCGGGCCGG
TTGGCGTTCGTGGCGCATCACCTGTCCGTCGACGCGGTCTCGTGGGGAATCCTGCTGCCG
GATCTGCAAACGGCGTACGACGAGGTGATCTCCGGCGGGACCCCGGCCCTCGAACCCCCG
ACGACGTCGTATCGGCAGTGGGCGCGCCGGCTGACCGAGCAGGCGCTCAGCGAGAGCACC
GTGGCCGAGCTCGACCAATGGGTCGCCGTACTGGACGGCGCCAACCCGCCACTGGAGCAG
GACACCGGACAGCACACGGGGCAGTCGCACTCGTGGTCCACGAGACTGTCCGGCACCGAG
GTGCGCAACCTGGTGGCTCACTTGCCAGGTGCCTTCCACTGCGGGATCCAGGACGTTCTG
TTGGCGGGCCTCGCGGGTGCGGTGGCGCGCGTGCGCGGCACCGGCGCCGGGCTGCTGGTG
GACGTCGAAGGCCACGGTCGCGAAGCCGCCGACGGCGAGGACCTGTTGCGCACCGTGGGC
TGGTTCACCAGCGTGCACCCGGTCCGCCTCGATCTGTCCGATGTGGACCTCGCGGCCGCG
GCAGCGGGCAACGCGCCGGCCGGGCAGTTGCTGAAGGCCGTGAAGGAACAGATCCGTGCC
GTGCCCGGCGACGGATCCGGCTACGGGCTGTTGCGCCATCTCAACCCCGACACCGGTGCG
CGGCTGGCCGAGTTGCCGTCCGCGCAGATCGGATTCAACTATCTCGGCCGGACCGTCCTC
GCCGCCCAGAACACCGCGTGGCAGCAGCCGGTGGCCGAGGGGCCGCTCGGCGGCGGTCCG
GACATGGTCCTTGCCCACGCCGTGGAGGTCAGCGCGGAACTGCTGGACACGCCCGCCGGA
CCCCGGCTGGGTCTGGCCATCGACACCCGGGATTTCGACCTCGCCACGGTGGAGCGGCTC
GGCGAGGCCTGGCTGGAGATGCTGACCGGCCTCGCGGCCATGGCCGGGAATCCCGGCGCG
GGCGGACACACACCATCCGACTTCGACCTGGTCGACCTGACGCAGCGGGACGTGACGGAG
CTGGAGGCCGCGGCGCCAGGGCTGACGGACATCTGGCCGCTGTCGCCGCTCCAGGAAGGC
ATGCTCTTCGAACGGGCCTTCGACGAGGACGGCGTCGACGTCTACCAGACGCAACGGATC
CTGGACCTCGACGGACCGCTTGACGCGCAACGGCTGCGTACGGCATGGAACCAGGTGGTC
GCCCGGCACGAATCGCTCCGGACCAGCTTCCACCAGCTCGGATCCGGCGAAACGGTGCAG
GTCGTCGCGCGCGAGGCCGACATCCCGTGGCGGGTGGCAGATCTGTCGCACCTCGATGAG
GCGGAGGCGGCCGCTGAGGTCGAACGGCTTCTCGCGCAGGATCAGGCCGAGCGGTTCGAC
GTGGCCACGGCGCCGCTGCTGCGGCTGTTGCTGATCCGTCTTGGTGCCGACAAACACAAA
CTCGTGATGACGTCGCACCACCTTCTCGTGGACGGCTGGTCGACACCGCTCATCGTGGGG
GAGATGTCGGCCGGCTACGCGGGTGGCCCGAGCGCGTCGAAGTCGCCGTCCTACAAGGAC
TATTTGGCGTGGTTGAGCCGTCAGGACGAGGAGACGACCCGATCGGCGTGGCGGTCCGAA
CTCGCCGGGTGCGACGAACCGACCTTGGTCGACGCCGACGCGGGCAAGACGTTGGTGATG
CCGGACAACCGTTCCGAATTGCTGTCCGAGGCCACGACGCGGACACTCGCCGATTTCGCA
CGAGGCCACGGACTGACGTTGAGCACGGTCGTGCTCGGCGCGTGGGCGTTGGTGCTGGCG
CGGTTGGCCGGCCGGACCGATGTGGTGTTCGGGTCGGTGGTGTCGGGGCGTCCGGCGGAC
GTGCCGGATGTCGAGCGAATGGTGGGGATGTTCATCAACACCGTCCCGGCCCGCGTGCGG
CTCGACGGCCGCCAGCCGGTCGTGGAGATGCTCAAGGACCTGCAGGGGCGCCAGTCGGCG
TTGACCGAGCACCAGTACATGGGGCTGCCGGAGATCCAGAAGGTGGCGGGGACGGGCGCG
ATCTTCGACACCATCGTGATGATCGAGAACTACCCGCACACCGCCGCCGGTCTCGGCGAC
GACGGCGGCGTGGTGATCAGCTCGGTCGCCACCCGGACCGGCACCAGCTACCCGCTGACG
ATGAACGTCAGCCTCGGGGAGCGCTTGCGGGTCAACGTGTCCTACCGGCCCGACCGGATC
GACGACGAAACGGCCACCGAGGTCGCCAGGCAGGTCGTGCGTGTCCTGGAACAGGTGGTG
GCGCAGCCTTTGCTGCCAGTGGGCCGCCTTGGCGTGACGAGCGAACCGGCGCGCGCGTCG
GTGGTGGAACGCTGGAACTCGACGGGCGAAGCGGCCAACAGGACGTCTGTGCTCGAGTTG
TTCCGGCAGCAGGCCGACGCCTCGCCGGACGCGGTGGCGGTCATGGACGCGGCACGCACC
CTGTCCTACGCCGACCTTGACCGGGAATCCGATCGGCTGGCCGGCTACCTGGCCGCGATG
GGCGTGCGGCGCGGTGACCGCGTTGGTGTGGTGATGGAACGCGGCACGGACCTGTTCGTC
GCTCTGCTCGCGGTCTGGAAGGCGGGGGCCGCGCAGGTACCGGTGAACGTGGACTACCCC
GCGGAACGCATCGAGCGGATGCTGGCCGACGCCGGCGCATCGGTCGCGGTCTGCCTGGAA
GCGACCCGCAAGGCGGTGCCGGACGGGGTCGAGCCGGTGGTCATGGACGTACCGGCGATC
GACGGAGTGCGGCACGAGGCACCACAGGTCACGGTCGGAGCGCACGACCTTGCCTACGTG
ATGTACACGTCGGGATCGACCGGGGTGCCGAAGGGCGTCGCGGTGCCGCACGGAAGCGTG
GCGGCACTGGCGAGCGACCCGGGTTGGTCGCAGGGCCCCGACGATTGCGTGCTGCTGCAC
GCGTCGCACGCGTTCGACGCGTCGCTGGTCGAGATCTGGGTGCCGCTGGTCAACGGATCC
CGCGTGATGGTCGCGGAACCGGGCGCGGTGGACGCGGAGCGGCTCCGCGAAGCGATCTCC
CGTGGCGTGACCACCGTCCACCTGACGGCAGGCGCTTTCCGGGCGGTGGCAGAGGAATCG
CCGGACTCCTTCACCGGACTGCGAGAAATCCTGACCGGCGGGGACGCGGTCCCACTCGCG
TCCGTCGTCCGGATGCGCCGGGCATGCCCGGACGTTCGAGTCCGGCAGCTGTACGGCCCC
ACCGAGATCACCCTCTGCGCCACGTGGCACGTCATCGAGCCAGGGGCCGAAACGGGCGAC
ACCTTGCCGATCGGCAGGCCGCTGGCCGGCCGGCAGGCGTATGTGCTCGACGCGTTCCTG
CAGCCGGTGGCTCCCAACGTGACCGGCGAGCTCTACATCGCAGGCGCCGGCCTGGCGCAC
GGATACCTGGGCAACAACGGATCGACCTCGGAGCGGTTCATCGCCAACCCGTTCGCCTCC
GGTGAGCGGATGTACCGCACGGGCGACCTGGCGCGCTGGACGGATCAGGGCGAGCTGCTG
TTCGCCGGTCGCGCCGACTCCCAGGTCAAGATCCGGGGCTACCGGGTCGAGCCCGGCGAG
ATCGAGGTGGCGCTGACCGAGGTCCCCCACGTCGCGCAGGCGGTCGTGGTGGCGCGGGAA
GACCACCCTGGCGACAAGCGCCTGATCGCGTACGTGACCGCGGAAGAAGGGCCGGCGCTG
GCTGCCGATGCGGTCCGTGAGCATCTCGCGGCGCGGATGCCGGAGTTCATGGTGCCGGCC
GTGGTGCTGGTGCTGGACAGCTTCCCGTTGACACTCAACGGAAAGATCGACCGCGCGGCC
CTGCCCGCACCCGAGTTCACCGGGAAGGCGGCCGGTCGCGAACCGCGCACCGAGACCGAG
CGAGTGTTGTGCGACCTGTTCGCCGAGATCCTCGGGCTGGACCGGGTCGGCGCCGACGAC
AGTTTCTTCGAGCTGGGCGGAGATTCGATCCTCTCGATGCGGCTGGCGGCCCGCGCGCGT
CGTGAGAACTTCGTCTTCGGGGCGAAGCAGGTCTTCGAGCAGAAGACGCCCGCGGGGATC
GCGGCCGTCGCCGAGCGCGGCGGACAGGCACGGGTCGAGGACGCCGAGGGCGTCGGTGAA
GTCCCGTGGACGCCGGTGGTGCGGGCAATGCTCGAACGCGACCCCATCGGGTTGACCCGA
GGTGCCATGGCGCAGTGGGTGACCGTGGACGTGCCCGACGACCTTTCGGTGACCGCGCTG
GCGGCCGGATTGGGCGCGGTGATCGACACCCACGACATGCTGCGGAGCCGGATCGTCGAT
ACCGAGGGCGCGGAGCCCCGGCTGGTCGTGGCCGGCCGTGGAACGGTGGACGCGTCGACG
CTGGTCGAACGGGTCGAGGCCGGTGCCGATGACGTCGACGAAATCGCGGATCGGTGCGCC
AATGACGCGGCGGCACGCCTGGATCCCGTTGCCGGCGTGATGGTCCGGGCAGTCTGGGTG
GACGCGGGACCAGGCCGCGCCGGGCGGCTCGTGGTGGCCGCGCATCACCTCGTGGTCGAC
GTGGTGTCGTGGCGAACCCTGCTGCCGGACCTGCAGGCGGCATGTGAAGCCGTGGCCGCG
GGCCTGCGGCCGGCGCTTGATCCGCCGGACGTCTCGTTCCGGCGTTGGGCGCGAACGCTG
GCCGATGAGGCAGCGATCCGGACCGCGGAGCTGGCGACGTGGACGGACATCCTCGATGGG
GCACGATCCCGGCTCGGCGAGCTCGATCCCAAGCGCGACACCGTATCGACCGCGGGACGC
AAGTCTTGGACCGTGCCGCAGAAGCACGCGGGCGTGCTCGTGGAGAAGGTCACGTCGGCC
TTCCACTGTGGAGTGCATGAGGTCTTGCTGGCGACCCTGGCAGGCGCCGTGGCCAGCTGG
CGCGGCGGCACCGACGTCGTGGTGGACGTCGAAGGTCACGGCCGTCAGCCCATCGGTGAG
ATGGACCTGTCGCGGACGCTCGGCTGGTTCACCGACGTGCATCCGCTCCGGCTGGATGTG
ACAGGCGTCGACACGGCCGAGGCGATCGCAGGCGGCGGCGCGGCCGGTCGTTTGCTCAAG
CAGGTCAAGGAGAACGTGCGAGCCGTGCCCGACGGCGGGCTCGGCTACGGGATGCTGCGT
TACCTCAACGCCGAGACGGGGCCGGTCCTCGCGGCGCTGCCGAAGGCGGAGATCGGGTTC
AACTACCTCGGCCGCTTCTCGTCGCGGCCCGACGGTGAAGCACAGCCTTGGCAGATAAAG
GGAATCGTCGGCGGCGCGGCAGAGCAGGACACGCCTTTGCGGCACGTCGTGGAGATCGAC
GCGGTCGTGCTGGACGGCGCAGACGGACCTGAGTTCACCCTGACCGTGACCTGGGCTGGC
CGGATTGTCGGTGATGCCGAGGCCGAGTCGTTCGCCAACGCGTGGCTGGACATGCTGAGC
GGCCTCGCCGCACACGTCGAAGCCGGCGGCGCCGGGGGACACACCCCATCCGACTTCCCG
CTCACCACGCTGACGCAGCGAGAGGTCGCGGAGATCGAGGCCGCCGTACCGAACCTGCTC
GACATCTGGCCGCTCTCCCCGCTTCAGGAGGGCTTGCTGTTCCACGCCGCAGACGAAGGC
GGACCGGACGTCTACGCGAGTATGCGGACCCTTGTCCTCGACGGCCCGCTGGACGTCGAC
CGGTTCCGTGCGTCCTGGCAGACCCTGCTCGACCGGCACGCCGCCCTGCGCGCGAGTTTC
CATCAGGTCGAGTCCGGTACGGCCGTGCAGGCGATCGCCCGCGAGGTGACGCTGCCCTGG
CGGGAGACCGACCTGTCCCATCTGCCCGAGGACGAGGCAGTGGCGGAATTCGACCGCCTC
GCGGCGGAGCTGCTCGCCGAACGGTTCGACCCGACCCAGGCGCCGCTGCTGCGCCTGCAC
CTCGTGCGCTTCGGCGAACGCGAGCACCGGCTGATCTTCACGTCGCATCACATCGCGGCT
GACGGCTGGTCTCTGCCGCTCATCGGCGTCGACGTGCTGGCGGCGTACGAAGCCGGCGGT
GATGGCCGGACGCTGCCTGCCGCGACGTCGTACCGCGACTACCTCGCCTGGATCGCCCGG
CAGGACAAGACAGCCGCCCGGGAGGCGTGGCGGACCGAACTGGCGGGCCTCGAGGAGGCG
ACCAATGTCGTGCCGCCGGAATCGATCCGCACGCCCCTGGTGCCCGAACGCGTCAGGTTC
GAACTCGGCGACGAGCCGAGCAGGCGCCTGGTCGAGTTCGCCCGACGGCACGGTGTCACG
CCGAACACGCTTTTCCAGGGGGTCTGGGCACTGCACCTGGCCCGGCTGACCGGACGCCAG
GACGTGGTCTTCGGCGCCGCGGTGGCCGGGCGCCCGCCCGAGATCCCCGGCGTGGAGTCC
TCGGTCGGCCTGTTCATGAACATGCTGCCGGTCCGGGCCCGTCTCACCGGCGCGCAACCG
GTCGTCGACATGCTGAAGGACTTGCAGGAACGGCAGATCGCGTTGATGTCGCACCAGCAC
ATCGGGCTGAGCGAGATCAAGCAGTTCGCCGGTCCCGGCGCGGCGTTCGACACGATCGTG
GTGTTCGAGAACTACCCGCCCCCGCCGCCTCGGTTCGACGGCCCCGACGCGCTCGTCATG
CGCCCCGCGGGGACTCCGAACGACACCGGGCACTATCCGCTGTCCATCCGCGCGTCTGTG
GCGGCAGGCCCCGTCCAAGGTGAATTCATCTACCGGCCGGACGTGGTCGACCGGGCCGAG
GCCGAGGAGATGGTCGCGGCGCTGCTGCGTGCGCTTGAGCAGGTGCTGGCCGATCCGCGG
ATGCCGGTGGGCCAGGTCGGCCTGATCGGCCCGCAGCAGCGTCGTCTGGTGGTGGACGAG
TGGAACCAGACCGACGCGCCGCTTGCGGCGGAGACGCTGCCGGTGTTGTTCCGCGAGCAG
GCGTGGCAGTCGCCGGATGCGGTGGCTGTTCAGGATGGGGTGCGGAGCCTGTCGTTCAGT
GGGTTGCTGGACGAGGTTGAGGCGCTGGCGCGGCTGCTCGTGGGGTTGGGCGTGCGGCGT
GAGGCCCGGGTGGGAGTGCTGGTCGAGCGTTCGGTCGAGCTGGCGGTGACCCTGATGGGG
GTGTCGTTCGCCGGCGGCGTGTTCGTGCCGGTCGATCCGGACTATCCCAGTGAGCGCATC
GAGTTCATGCTGGCCAACTCGGCGCCAGAGGTGCTGGTGTGCACGAAGACGACCCGAGCG
GTCGTGCCTGCGCAGTTCACGGGCACGGTGCTGGTGCTGGACGAGCTGCCCGCCGCCGAT
CCGGGCGTCGAGTTGCCGGACGTGGCACCGGAAGACGCGGCCTACGTGATCTACACGTCG
GGGTCGACGGGAGTGCCCAAGGGCGTCCTGGTCACCCACTCCGGGCTCGTCAACCTGGGG
TACGCGCACATCGAGCGGATGGCCGTGACGTCGTCCTCGCGGGTGCTGCAGTTGTCCGCG
ATCGGATTCGACGCCATCGTCTCCGAGCTCTACATGGCTCTGCTGGCCGGTGCGACCTTG
GTACTGCCGGATTCGGCGAACATGCCGCCCCGGGTGACGCTGGGCGACGCGATCCGCAAG
GCGGGTATCACGCACCTGACCGTGTCGCCGAGTGTGCTGGCGAGTGAGGACGACCTGCCG
GACACCCTGCAGACCGTGTTGACGGGCGGCGAGGCACTACCCGCCGCGCTGGTGGACCGT
TGGTCGCCGGGCCGCCGGGTGATCCAGGCCTACGGGCCGACAGAGACGACCATCTGCTCG
ACGATGAGTGCCCCGTTGTCGCCGGGACACGACCAGGTCCCGCTCGGCGGCCCGATCTAC
AACGTGCGGCACTACGTGCTCGACGCGTTCCTGCAGCCAGTGCCGCCCGGGGTGGTCGGC
GAGCTCTACATCACGGGCGTCGGACTGGCTCGTGGATACCTCGGCCGCCCTGGCCTGACG
GCGGAACGGTTCGTCGCCAGCCCGTTCGCCCCCGGTGAGCGGATGTACCGCTCCGGCGAC
CTGTTCCGCTGGACCCGGGAGGGCCAGCTGATGTTCGCGGGCCGAGTGGACGCGCAGGTC
AAGGTGCGTGGGTACCGGGTCGAGCCAGCCGAGATCGAGGCCGTGCTCATCGAGCATCCG
GGGGTCGCTCAGGTCGCGGTCGCCGTCCGCAGGGACGGGCCGGGCGACAAGCAGCTGGTG
GCGTATGTCGTGCCATCGGCCGACGCTGCAGGCGAGAACGGCACGCTGACGTCCGCGCTG
CGTGAGCTGGCGGCCGAACGCCTGCCGGAGTACATGATGCCCGCGGCGTTCGTGTCGCTG
GAGAAGATGCCGCTGACCCCGAACGGCAAGCTCGACCACAAGGCGTTGCAGGCACCCGAC
TTCGCCGCGATGTCAACGAAGCGGGACCCGAGCACGCCCATGGAGGCGCGGCTGTGCGAG
TTGTTCGCGGACGTGCTCGGCCTTGAACAGGTGGGCGTCGACGACAGCTTCTTCGAGCTC
GGCGGCGACTCGATCACCTCGATGCAGCTGTCCGCCCGAGCACGCCGCGAAGGGCTGGAA
CTGACGCCGTGGCAGGTGTTCGACGAGAAGACGCCGGAACGGCTGGCGGCCATGGTCAAA
GAGATCCAGGCCGAGGAGGAGACCGCCGCGGTGCCGAAGCCCGCGGCAGGAACGCTCCTT
GCTCTTTCGGCTGACCAGATGAACCAACTCGAGGCCGGACTGGCCGGTGAGTAA
[4] C7..301
[4] A482..879
[4] L-4-hydroxyphenylglycine(Hpg)649..749
[4] PCP957..1023
[4] E1063..1501
[5] C1510..1801
[5] A1982..2376
[5] L-4-hydroxyphenylglycine(Hpg)2146..2246
[5] PCP2459..2525
[5] E2563..3012
[6] C3023..3314
[6] A3499..3887
[6] beta-hydroxytyrosine(Bht)3664..3759
[6] PCP3974..4040
[4] C19..903
[4] A1444..2637
[4] L-4-hydroxyphenylglycine(Hpg)1945..2247
[4] PCP2869..3069
[4] E3187..4503
[5] C4528..5403
[5] A5944..7128
[5] L-4-hydroxyphenylglycine(Hpg)6436..6738
[5] PCP7375..7575
[5] E7687..9036
[6] C9067..9942
[6] A10495..11661
[6] beta-hydroxytyrosine(Bht)10990..11277
[6] PCP11920..12120

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [482-879]  3.90000000000001e-111 PF00501 [1982-2376]  3.99999999999998e-106 PF00501 [3499-3887]  1.29999999999998e-108 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [7-301]  3.70000000000004e-65 PF00668 [1063-1332]  1.6e-30 PF00668 [1510-1801]  2.09999999999996e-68 PF00668 [2563-2840]  1.8e-32 PF00668 [3023-3314]  2.59999999999998e-61 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [982-997]  PS00012 [2484-2499]  PS00012 [3999-4014]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [957-1023]  PS50075 [2459-2525]  PS50075 [3974-4040]  PS50075
PS50075   ACP_DOMAIN
 [947-1025]  1.10000000000001e-75 G3DSA:1.10.1200.10 [2450-2526]  1.10000000000001e-75 G3DSA:1.10.1200.10 [3966-4044]  1.10000000000001e-75 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [950-1024]  2.800005042611e-19 SSF47336 [2452-2526]  2.10000267834031e-17 SSF47336 [3967-4041]  3.60000433965927e-19 SSF47336
SSF47336   ACP_like
 [960-1021]  3e-13 PF00550 [2462-2522]  2e-10 PF00550 [3977-4039]  5.5e-13 PF00550
PF00550   PP-binding
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1348-1501]  9.29999999999998e-30 TIGR01720 [2855-3012]  1.70000000000001e-41 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [482-879]  TIGR01733 [1982-2376]  3.60000000000002e-123 TIGR01733 [3499-3887]  2.59999999999995e-123 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [958-1026]  1.09999909120787e-13 SM00823 [2460-2528]  3.6000003870074e-06 SM00823 [3975-4043]  1.6999992228405e-08 SM00823
SM00823   PKS_PP
IPR020845 AMP-binding, conserved site (Conserved_site)
 [603-614]  PS00455 [2100-2111]  PS00455 [3616-3627]  PS00455
PS00455   AMP_BINDING
IPR023213 Chloramphenicol acetyltransferase-like domain (Domain)
 [49-161]  5.59999999999999e-13 G3DSA:3.30.559.10
G3DSA:3.30.559.10   CAT-like_dom
SignalP No significant hit
TMHMM No significant hit