close all open/close all

CDS information : Chlor_00050


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction25,415 / 30,997 / + [in whole cluster]
25,415 / 30,997 / + [in contig]
Location25415..30997 [in whole cluster]
25415..30997 [in contig]
TypeCDS
Length5,583 bp (1,860 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)PCZA363.5
GenecepC
ORF5
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • similar to peptide synthetase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[17506888] Phylogenetic analysis of condensation domains in NRPS sheds light on their functional evolution. (BMC Evol Biol. , 2007)
Related Reference
ACC
Q939Y9
NITE
Balhi_00090
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)
[15651041] The biosynthesis of vancomycin-type glycopeptide antibiotics--a model for oxidative side-chain cross-linking by oxygenases coupled to the action of peptide synthetases. (Chembiochem. , 2005)
[17506888] Phylogenetic analysis of condensation domains in NRPS sheds light on their functional evolution. (BMC Evol Biol. , 2007)
ACC
Q70AZ6
NITE
Teicp2_00210
PmId
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[26549530] Sequential In Vitro Cyclization by Cytochrome P450 Enzymes of Glycopeptide Antibiotic Precursors Bearing the X-Domain from Nonribosomal Peptide Biosynthesis. (Angew Chem Int Ed Engl. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)

close this sectionPKS/NRPS Module

A7 L-3,5-dihydroxyphenylglycine(Dpg)
C15..310
A493..889
PCP967..1038
X1052..1351
TE1624..1841

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [PCZA363.5]
MTVDDTRAKPRSSVEDVWPLSPLQQGMLYHTALDNDGPDTYTVQTVYGIDGPLDAGLLRA
SWQALVDRHAALRACFRYVSGAQMVQVIARDAEIPWNETDLSGLPEDIADSEVDRLAAQE
VAERLRIEVAPLMKLHLIRLGPESHRLVHTLHHVLVDGWSMPIIHRELAAIYAAGGDASG
LPPTVSYRDYLAWLGRQDKDVAIAAWRKELAGLETPTTVAPADPTRVPDIDTVVIELSTQ
LTDDLYRLARGHDLTLNTVVQGAWAVVLSQLAGRNDVVFGATASGRPADLPGVEAMVGQL
LTTLPVRVRLDGERRAVDLFAQLQRDQSALMAHQHLGLQDVQAVVGRGAVFDTLVIYENF
PRKGLGRAPDGGLTLLPVKRGRNSSHYPFTLVTGPGEQMPLILDYDRGLFDPAAAESVVG
ALARVLERLVAEPDILVGRLTLVSEAERALVVDEFNATAGPVPGESVVELFAHRVAEAPD
AVAITDAGGANLTYAEVDRASNRLAGYLAGRGVGRGDRVGVAMDRSPELLIAFLAIWKAG
AAYVPVDVEYPAERIAFILNDSGVSTVLCTQDTSGVVPENAIVLDAPDTRASIEDCADTA
PEIRLYAGDLAYVMYTSGSTGLPKGVAIPHGAVAGLAGDSGWQIGPDDGVLMHATHVFDP
SLYAMWVPLVAGGRVLLTEPGVLDAAGVRQAVERGATAVHLTAGSFRALAETSPECFAGL
VEIGTGGDVVPAQSVANLRRAQPGLRVRNTYGPTETTLCATWLPIEPGDVIDRELPIGHP
MTNRKIYILDAFLRPVPPGVAGELYIAGTGLARGYLDSPGLTADRFVACPFLAGERMYRT
GDVARWTRDGEVVFLGRADDQVKIRGYRVELGEVEAVLAAQPGVVEAVVMAREDQPGEKR
LVGYFVSDGSDAGPAEIRRQMAQVLPDYMVPIAVVALPGLPVTPNGKVDRRALPAPDLAG
RSSEKAPENETEKVLCALFGEILSVDQVGVDDTFNDLGGSSALAMRLIARIREELGADLP
IRQLFSSPTPAGLARALAAKSRPALEAAQRPDRVPLTARQLRAWLLARPGEDTADQHVSI
TLRLGGKLNVPALAAAIGDVAARHEILRTTFPGDAQSVHQHVHDALAIELTPVPATEEDL
PGLLAERRESVFDLTQEVPWRCDLFQLSEKDHVLQVKIHRILADDDSMDVFFRDLAAAYG
ARREGRVPERAPLALQFADFAIWEHRLLEDEQELDSLINEQIVFWRDNLAGIDGETVLPF
DRPRSAVPSRRAGTVALRLDADPHARLTAVAEPVGADTLQMVHAALAMLLAKFGAGHDVV
IGTTLPRDEELFDLEPMIGPFTRPLALRTDVSGDPTFLEVVTRVQEAAQAAGEHLDVPFE
RIVELLDLPASLSRHPVFQVGLQVDEEDIDGWDAAELPALRTSVEPGGTEAMELDLAVKL
TERFDDDDNSGGIEGALHYATDLFDEATAESVARRLVRVLEQVAEDPQRRISDLDIFLDD
FERGRPAIAPARWSGAVPAVVADLAQDGPLGALLLDEQLRPVAPGAVGDLYVTGPAVDAG
TAGLPTMPCPFGTPGHQMMHTGLLARKSHTKALVVVGERRRSSASVKTGDFEILLPLRVG
GDRPPLFCVHASGGLSWNYEPLLRYLPPNQPVYGVQARGLARTEPLPGSVDEMAADYLEQ
IRAVQPTGPYHLLGWSLGGRIAQAMAKLLEAEGEQVGLLALLDAYPVYMGRKTTGAASEE
EALERRNQQDLELAGQLVKGAAARSRLEAVMRNLWDVGPRHVSTPFAGDILLFVATVDRP
GHLPVPVAKDSWKDFTSGAIEAHEIASNHYDMVQPAALGQIGAIVAEKLRSRPDAERTQR
selected fasta
>non-ribosomal peptide synthetase [PCZA363.5]
GTGACCGTTGACGACACTCGCGCGAAGCCGCGCTCCAGTGTGGAAGACGTCTGGCCGCTT
TCCCCGCTGCAGCAAGGAATGCTCTACCACACCGCCCTCGACAACGACGGGCCGGACACG
TACACCGTGCAGACCGTCTACGGCATCGACGGCCCGCTGGACGCCGGGCTGCTGAGGGCG
TCGTGGCAGGCCCTCGTGGACCGGCATGCCGCGCTGCGGGCCTGTTTCCGCTATGTCAGC
GGCGCGCAGATGGTGCAGGTCATCGCGCGGGACGCCGAGATTCCGTGGAACGAGACGGAT
CTTTCCGGGCTGCCTGAGGACATCGCCGACAGCGAGGTGGACCGGCTGGCGGCGCAAGAG
GTGGCCGAGCGGCTGCGCATCGAGGTGGCGCCGCTGATGAAACTGCACCTGATCCGGCTC
GGCCCGGAGAGCCACCGGCTCGTGCACACGCTGCATCACGTGCTGGTCGACGGCTGGTCG
ATGCCGATCATCCACCGCGAACTCGCCGCCATCTACGCGGCGGGCGGTGACGCGTCCGGG
CTCCCGCCCACGGTGTCCTATCGGGACTATCTCGCGTGGCTTGGCCGGCAGGACAAGGAC
GTTGCCATCGCGGCATGGCGCAAGGAGCTGGCCGGGCTGGAGACGCCGACCACGGTCGCC
CCGGCCGATCCGACCCGCGTGCCGGACATCGACACAGTCGTGATCGAGTTGTCCACACAG
CTGACGGACGATCTGTACCGGCTAGCGCGCGGCCACGACCTCACCCTGAACACGGTCGTG
CAGGGCGCTTGGGCCGTTGTGCTGTCGCAACTCGCCGGCCGCAACGACGTGGTTTTCGGC
GCGACCGCCTCGGGGCGGCCGGCCGACCTGCCCGGTGTGGAGGCGATGGTCGGCCAGCTG
CTCACCACGCTGCCAGTCCGTGTCCGGCTCGACGGCGAGCGGCGGGCGGTCGACCTGTTC
GCCCAGCTGCAGCGCGACCAGTCGGCACTCATGGCTCACCAGCATCTCGGCCTGCAGGAC
GTGCAGGCCGTCGTCGGCCGCGGAGCGGTCTTCGACACGCTCGTCATCTACGAGAACTTC
CCCCGCAAGGGACTCGGCCGGGCGCCGGACGGCGGCCTGACCCTGCTCCCGGTCAAGCGC
GGGCGCAACTCGTCGCACTACCCGTTCACCCTGGTCACCGGTCCAGGCGAGCAGATGCCG
CTCATCCTCGACTACGACCGTGGCCTCTTCGACCCCGCTGCCGCCGAGTCTGTCGTCGGC
GCGTTGGCTCGCGTGCTGGAGCGGCTGGTCGCCGAGCCTGATATCCTCGTCGGCCGTCTG
ACGCTGGTGAGCGAGGCAGAGCGTGCCCTGGTGGTTGACGAATTCAACGCGACCGCGGGC
CCGGTGCCGGGGGAGTCCGTAGTCGAGCTGTTCGCCCACCGGGTGGCCGAAGCGCCGGAC
GCGGTGGCGATCACCGATGCCGGCGGCGCGAACCTGACCTACGCCGAAGTCGACCGGGCG
TCGAACCGGCTGGCCGGCTACCTCGCCGGTCGTGGCGTCGGCCGTGGCGACCGCGTCGGG
GTGGCCATGGACCGCTCGCCGGAGCTGCTGATCGCGTTCCTGGCGATCTGGAAGGCAGGC
GCCGCGTACGTCCCGGTGGACGTCGAGTACCCGGCCGAGCGGATCGCGTTCATTCTCAAC
GACTCCGGGGTCTCGACCGTTCTGTGCACTCAGGACACCAGCGGAGTCGTGCCGGAGAAC
GCGATCGTCCTCGACGCGCCGGACACGCGTGCGTCCATTGAGGACTGTGCGGACACGGCG
CCGGAGATCCGGCTGTACGCAGGCGACCTGGCGTACGTGATGTACACCTCGGGATCCACC
GGCCTGCCGAAGGGCGTGGCCATCCCGCATGGGGCAGTGGCCGGCCTGGCCGGCGACTCG
GGCTGGCAGATCGGTCCCGATGACGGCGTGCTGATGCACGCGACACACGTCTTCGACCCC
TCGCTCTACGCGATGTGGGTGCCGCTCGTCGCGGGTGGCCGGGTCTTGCTCACCGAGCCG
GGCGTGTTGGACGCGGCCGGGGTACGTCAGGCCGTCGAACGGGGTGCGACCGCCGTGCAC
CTCACCGCCGGTTCCTTCCGTGCCCTGGCGGAAACGTCTCCGGAGTGTTTCGCGGGTCTT
GTCGAGATCGGGACCGGCGGAGACGTGGTTCCCGCGCAGTCCGTGGCGAACCTGCGGCGG
GCCCAGCCCGGCCTGCGGGTGCGCAACACCTACGGGCCGACCGAGACCACCCTGTGCGCG
ACGTGGCTGCCGATCGAGCCCGGTGACGTGATCGATCGGGAGCTGCCGATCGGCCACCCG
ATGACCAACCGCAAGATCTACATCCTCGACGCCTTCCTGCGACCGGTCCCGCCGGGAGTG
GCAGGCGAGCTGTACATCGCGGGCACGGGTCTGGCCCGTGGCTACCTCGACAGCCCGGGC
CTGACGGCCGACCGATTCGTGGCGTGCCCGTTCCTCGCCGGTGAACGCATGTACCGCACC
GGTGACGTGGCGCGCTGGACCCGTGATGGTGAGGTGGTGTTCCTCGGCCGCGCCGACGAC
CAGGTGAAGATCCGCGGCTACCGGGTCGAGCTTGGCGAAGTCGAGGCCGTGCTGGCGGCC
CAGCCGGGAGTGGTCGAGGCGGTCGTCATGGCGCGGGAGGACCAGCCCGGTGAGAAGCGC
CTGGTCGGCTACTTCGTGTCCGACGGCAGCGACGCGGGCCCAGCCGAGATCCGCAGGCAA
ATGGCCCAGGTCCTGCCCGACTACATGGTTCCGATCGCGGTCGTCGCCCTGCCCGGCCTG
CCTGTCACACCCAACGGCAAGGTGGATCGCCGGGCCCTGCCCGCCCCGGACCTCGCCGGA
CGCTCGTCGGAGAAAGCGCCTGAGAACGAGACCGAGAAGGTGCTGTGCGCGCTGTTCGGC
GAGATCCTCAGCGTCGACCAGGTGGGCGTCGACGACACCTTCAACGACCTCGGCGGCAGT
TCGGCGCTGGCCATGCGGCTGATCGCGCGGATCCGTGAGGAACTCGGCGCGGATCTGCCC
ATCCGGCAGCTGTTCTCCTCGCCCACACCCGCGGGTCTGGCCAGGGCACTTGCCGCGAAG
TCACGCCCCGCACTGGAAGCCGCCCAGCGGCCGGACCGGGTGCCCCTCACCGCCCGGCAG
CTGCGTGCCTGGCTGCTGGCGCGTCCCGGCGAGGACACTGCCGACCAGCACGTCTCGATC
ACGCTGCGCTTGGGCGGCAAGTTGAACGTGCCCGCGCTGGCGGCGGCGATCGGCGATGTC
GCGGCCCGCCACGAGATCCTCCGCACGACCTTCCCGGGTGACGCGCAGAGCGTTCACCAG
CACGTCCACGACGCCTTGGCAATCGAGCTGACTCCCGTCCCGGCCACCGAGGAGGACCTC
CCCGGGTTGCTCGCCGAGCGGCGTGAGTCGGTGTTCGACCTCACCCAGGAGGTGCCGTGG
CGATGTGACCTTTTCCAGCTCTCGGAAAAGGACCACGTGCTGCAGGTGAAGATCCACCGG
ATCCTCGCTGACGACGACTCGATGGACGTGTTCTTCCGTGACCTGGCGGCCGCGTACGGC
GCGCGGCGTGAAGGCCGGGTCCCTGAGCGTGCGCCACTCGCCCTGCAGTTCGCCGACTTC
GCGATCTGGGAGCACCGGCTTCTCGAGGATGAGCAAGAGCTGGACAGCCTGATCAACGAG
CAGATCGTCTTCTGGCGGGACAACCTCGCCGGTATCGACGGGGAGACGGTGCTCCCGTTC
GACCGCCCGCGCTCGGCTGTCCCGTCGCGGCGGGCGGGCACGGTCGCGCTGCGGCTGGAC
GCCGATCCGCACGCCCGGTTGACGGCAGTGGCAGAGCCGGTAGGCGCGGACACGCTCCAG
ATGGTGCACGCCGCGCTCGCCATGCTGCTGGCCAAGTTCGGAGCCGGCCACGACGTGGTG
ATCGGCACGACGCTGCCGCGGGACGAGGAGCTCTTCGATCTCGAGCCGATGATCGGGCCG
TTCACCCGGCCGCTCGCCCTGCGCACGGACGTCTCGGGCGACCCGACCTTCCTTGAGGTC
GTCACCAGGGTGCAGGAGGCTGCCCAGGCCGCGGGCGAGCACCTGGACGTGCCCTTCGAG
AGGATCGTCGAGCTGCTGGACCTGCCGGCCTCGCTGTCCCGCCACCCGGTGTTCCAGGTG
GGACTGCAGGTGGACGAGGAGGACATCGACGGGTGGGACGCGGCGGAACTGCCCGCCCTG
CGCACCAGCGTCGAACCCGGCGGGACCGAGGCCATGGAGCTGGATCTCGCGGTCAAGCTC
ACCGAGCGCTTCGATGACGACGACAACTCGGGCGGCATCGAGGGTGCGCTGCACTACGCC
ACCGACCTGTTCGATGAGGCCACAGCCGAGTCGGTGGCCCGCCGGCTGGTCCGAGTCCTT
GAACAGGTGGCTGAGGATCCCCAGCGGCGGATCAGCGACCTGGACATCTTCCTGGACGAC
TTCGAACGCGGCCGTCCGGCCATCGCACCGGCGCGGTGGTCCGGGGCCGTACCCGCGGTG
GTCGCCGACCTGGCGCAGGACGGCCCGCTTGGTGCGCTCCTGCTCGACGAGCAGCTGCGC
CCCGTGGCTCCCGGGGCGGTCGGCGATCTTTACGTCACCGGTCCGGCAGTGGACGCGGGA
ACGGCCGGTCTGCCGACCATGCCGTGTCCATTTGGGACTCCCGGGCACCAGATGATGCAC
ACGGGCCTGCTTGCTCGTAAGTCCCACACCAAGGCTTTGGTCGTCGTGGGCGAGCGGCGG
CGATCAAGCGCCTCGGTGAAGACGGGTGACTTCGAGATCCTGCTGCCGCTGCGAGTCGGC
GGTGACCGCCCGCCACTGTTCTGTGTCCACGCGAGCGGTGGCCTGAGTTGGAACTACGAG
CCGTTGCTGCGGTATCTCCCGCCGAATCAACCGGTCTACGGCGTGCAGGCACGCGGCTTG
GCCCGTACCGAACCTTTGCCGGGCAGCGTCGACGAGATGGCGGCCGACTACCTCGAGCAG
ATCCGCGCCGTGCAGCCGACCGGGCCGTACCACCTCCTCGGCTGGTCCCTCGGCGGCAGG
ATCGCGCAGGCGATGGCCAAATTGCTTGAGGCGGAAGGGGAACAGGTCGGCCTGCTCGCT
CTGCTCGACGCGTATCCCGTCTACATGGGACGCAAGACGACCGGCGCCGCGAGCGAGGAA
GAGGCCCTCGAAAGGCGCAACCAGCAGGACTTGGAGCTCGCGGGGCAACTGGTCAAGGGG
GCAGCGGCCCGGTCGCGCCTTGAGGCGGTCATGCGCAACCTCTGGGATGTCGGGCCACGC
CACGTCTCCACGCCGTTCGCCGGCGACATTCTGCTCTTTGTGGCCACTGTGGACCGTCCA
GGGCATCTGCCCGTCCCGGTGGCGAAAGACAGCTGGAAGGACTTCACCAGCGGGGCCATC
GAGGCTCACGAGATCGCGTCCAACCACTACGACATGGTGCAACCCGCGGCGCTGGGCCAG
ATTGGAGCCATCGTCGCCGAGAAACTCCGGTCCCGGCCGGATGCTGAAAGGACACAACGA
TGA
[7] C15..310
[7] A493..889
[7] L-3,5-dihydroxyphenylglycine(Dpg)659..759
[7] PCP967..1038
[7] X1052..1351
[7] TE1624..1841
[7] C43..930
[7] A1477..2667
[7] L-3,5-dihydroxyphenylglycine(Dpg)1975..2277
[7] PCP2899..3114
[7] X3154..4053
[7] TE4870..5523

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [493-889]  4.49999999999996e-108 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [1624-1841]  4.10000000000004e-37 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [15-310]  1.5e-64 PF00668 [1052-1351]  1.40000000000001e-47 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [962-1041]  3.09999999999998e-25 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [967-1038]  PS50075
PS50075   ACP_DOMAIN
 [964-1039]  9.39998942703831e-19 SSF47336
SSF47336   ACP_like
 [974-1037]  3.5e-13 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [493-889]  9.10000000000013e-126 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [613-624]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit