close all open/close all

CDS information : Chlor_00100


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction34,245 / 35,258 / + [in whole cluster]
1 / 1,014 / + [in contig]
Location34245..35258 [in whole cluster]
1..1014 [in contig]
TypeCDS
Length1,014 bp (337 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450(fragment)
Product (GenBank)PCZA361.27
GenecepG
oxyC
ORF9
Gene (GenBank)
EC number
Keyword
  • 3rd cross-linking
  • AB ring
Note
  • C-terminal sequence of Chlor_00090(nt.34133-) overlap with N-terminus of Chlor_00100.
Note (GenBank)
  • similar to P450 related oxidase/hydroxylase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[12596194] Vancomycin assembly: nature's way. (Angew Chem Int Ed Engl. , 2003)
Related Reference
ACC
O87675
NITE
Balhi_00130
PmId
[12404385] The Biosynthesis of Vancomycin-Type Glycopeptide Antibiotics-The Order of the Cyclization Steps This work was supported by the Deutsche Forschungsgemeinschaft (SFB 323) and by a grant of the EU (MEGATOP, QLK3-1999-00650). R. D. S. gratefully acknowledges the support of a Feodor-Lynen Fellowship granted by the Alexander-von-Humboldt Stiftung. We thank Corina Bihlmaier and Volker Pfeifer for help with transformation and Southern hybridization, J. A. Moss (La Jolla (USA)) for critical comments on the manuscript and Prof. Dr. M. E. Maier and Prof. Dr. H.-P. Fiedler (Tubingen) for generous support. (Angew Chem Int Ed Engl. , 2001)
[16730832] Genetic analysis of the balhimycin (vancomycin-type) oxygenase genes. (J Biotechnol. , 2006)

close this sectionSequence

selected fasta
>putative cytochrome P450(fragment) [PCZA361.27]
DHENFTTRPQFTHAKSDAHVEAQFVGQISTYDPPEHTRLRKMLTPEFTVRRIRRMEPAIQ
GLIDDRLDMVEAEGPPADLQGLFADPVGALALCELLGIPRDDQREFVRRIRRNTDLSRGL
KARAADSAAFNRYLDNLISRQRKDPDEGFLGMIVREHGDNVTDEELKGLCTALILGGVET
VAGMIGFGVLALLENPDQIQLLFAGPEKADRVVNELVRYLSPVQAPNPRLAIKDVVIDGQ
LIKAGDYVLCSVLMANRDEALTPNPNVLDANRAAVSDVGFGHGIHYCVGAALARSMLRMA
YQTLWQRFPGLRLAVPIAEVKYRSAFVDCPDQVPVTW
selected fasta
>putative cytochrome P450(fragment) [PCZA361.27]
GATCACGAGAATTTCACGACGCGGCCGCAATTCACCCATGCGAAATCTGACGCACACGTA
GAGGCCCAGTTCGTCGGACAGATATCGACTTACGATCCGCCTGAGCACACTCGCCTGCGA
AAGATGCTGACGCCGGAGTTCACGGTGCGGCGGATTCGCCGGATGGAGCCCGCGATTCAG
GGCCTCATCGATGATCGCCTCGACATGGTGGAGGCCGAGGGGCCGCCCGCGGATCTCCAA
GGGTTGTTCGCCGACCCGGTCGGCGCTCTCGCCCTGTGTGAACTGCTCGGCATTCCGCGC
GATGACCAGCGTGAGTTCGTCCGGAGGATCAGGCGGAACACCGATCTGAGCCGGGGACTC
AAGGCACGGGCGGCCGACAGCGCGGCGTTCAACCGGTACCTGGACAACCTCATCTCCCGG
CAGCGCAAGGACCCCGACGAGGGGTTTCTCGGCATGATCGTGCGAGAGCACGGTGACAAC
GTCACCGACGAGGAACTGAAGGGCCTGTGCACGGCGCTGATCCTCGGCGGTGTCGAGACC
GTCGCGGGGATGATCGGCTTCGGAGTGCTCGCCCTGCTGGAGAATCCTGACCAGATCCAG
TTGCTTTTCGCCGGCCCCGAGAAGGCCGACCGCGTCGTCAACGAGCTGGTGCGTTATCTG
TCCCCGGTGCAGGCGCCGAATCCACGCCTCGCCATCAAGGACGTCGTCATCGACGGACAG
TTGATCAAGGCAGGTGATTACGTCCTGTGCTCGGTTCTCATGGCCAACCGAGATGAAGCG
CTGACGCCGAATCCCAACGTTCTCGACGCGAATCGCGCCGCGGTGTCGGACGTCGGATTC
GGGCACGGCATCCATTACTGCGTGGGCGCGGCGCTGGCCCGGTCGATGCTGCGGATGGCT
TATCAGACCCTGTGGCAGCGATTTCCCGGGCTGCGGCTGGCAGTGCCGATCGCGGAAGTG
AAGTACCGCAGTGCGTTCGTCGACTGCCCTGATCAGGTTCCAGTCACCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [2-337]  4.49999999999996e-84 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [1-337]  1.59998835313644e-84 SSF48264
SSF48264   Cytochrome_P450
 [210-308]  7.5e-13 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [31-42]  1.49999648196323e-46 PR00359 [78-94]  1.49999648196323e-46 PR00359 [95-110]  1.49999648196323e-46 PR00359 [132-154]  1.49999648196323e-46 PR00359 [211-222]  1.49999648196323e-46 PR00359 [229-256]  1.49999648196323e-46 PR00359 [257-272]  1.49999648196323e-46 PR00359 [278-287]  1.49999648196323e-46 PR00359 [287-298]  1.49999648196323e-46 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [280-289]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit