close all open/close all

CDS information : Chlor_00120


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction36,840 / 38,030 / + [in whole cluster]
2,596 / 3,786 / + [in contig]
Location36840..38030 [in whole cluster]
2596..3786 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-L-4-epivancosamine glycosyltransferase
chloroorienticin B synthase
Product (GenBank)PCZA361.19
GenegtfA
ORF11
Gene (GenBank)
EC number2.4.1.311
Keyword
  • L-4-epivancosamine
  • Bht6
Note
Note (GenBank)
  • similar to glycosyltransferase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[9115410] Production of hybrid glycopeptide antibiotics in vitro and in Streptomyces toyocaensis. (Chem Biol. , 1997)
[12874381] Structure of the TDP-epi-vancosaminyltransferase GtfA from the chloroeremomycin biosynthetic pathway. (Proc Natl Acad Sci U S A. , 2003)
[15070728] Characterization of a regiospecific epivancosaminyl transferase GtfA and enzymatic reconstitution of the antibiotic chloroeremomycin. (Proc Natl Acad Sci U S A. , 2004)
[16045364] A systematic investigation of the synthetic utility of glycopeptide glycosyltransferases. (J Am Chem Soc. , 2005)
[19549605] Chimeric glycosyltransferases for the generation of hybrid glycopeptides. (Chem Biol. , 2009)

close this sectionSequence

selected fasta
>dTDP-L-4-epivancosamine glycosyltransferase [PCZA361.19]
MRVLITGCGSRGDTEPLVALAARLRELGADARMCLPPDYVERCAEVGVPMVPVGRAVRAG
AREPGELPPGAAEVVTEVVAEWFDKVPAAIEGCDAVVTTGLLPAAVAVRSMAEKLGIPYR
YTVLSPDHLPSEQSQAERDMYNQGADRLFGDAVNSHRASIGLPPVEHLYDYGYTDQPWLA
ADPVLSPLRPTDLGTVQTGAWILPDERPLSAELEAFLAAGSTPVYVGFGSSSRPATADAA
KMAIKAVRASGRRIVLSRGWADLVLPDDGADCFVVGEVNLQELFGRVAAAIHHDSAGTTL
LAMRAGIPQIVVRRVVDNVVEQAYHADRVAELGVGVAVDGPVPTIDSLSAALDTALAPEI
RARATTVADTIRADGTTVAAQLLFDAVSLEKPTVPA
selected fasta
>dTDP-L-4-epivancosamine glycosyltransferase [PCZA361.19]
ATGCGCGTGTTGATTACGGGGTGTGGATCGCGCGGAGATACCGAACCGTTGGTGGCATTG
GCGGCACGGTTGCGGGAACTCGGTGCGGACGCGCGGATGTGCCTGCCGCCGGACTACGTG
GAGCGGTGCGCCGAGGTCGGTGTGCCGATGGTGCCGGTCGGTCGGGCGGTGCGCGCAGGG
GCACGCGAGCCGGGAGAACTGCCGCCGGGGGCGGCCGAAGTCGTGACCGAGGTGGTCGCC
GAATGGTTCGACAAGGTCCCGGCGGCCATCGAGGGGTGTGACGCGGTGGTGACGACCGGC
TTGCTGCCCGCCGCGGTCGCTGTCCGGTCGATGGCCGAGAAGCTGGGCATCCCGTACCGC
TACACCGTGCTGTCTCCGGACCATCTGCCGTCGGAGCAAAGCCAGGCGGAGCGGGACATG
TACAACCAGGGCGCCGACAGGCTTTTCGGTGACGCGGTCAACAGCCACCGGGCCTCGATC
GGCCTGCCACCGGTGGAGCACCTCTACGACTACGGCTACACCGATCAGCCCTGGCTGGCG
GCGGACCCGGTGCTGTCCCCGCTGCGGCCGACGGACCTCGGCACTGTGCAGACCGGTGCG
TGGATCCTGCCCGACGAACGGCCGCTTTCCGCGGAGCTGGAGGCGTTTCTGGCTGCCGGG
TCGACGCCGGTGTACGTGGGTTTCGGCAGCTCGTCCCGACCGGCAACCGCTGACGCCGCG
AAGATGGCCATCAAGGCGGTCCGTGCCAGTGGCCGCCGGATCGTTCTCTCCCGCGGCTGG
GCCGATTTGGTCCTGCCGGACGACGGGGCCGACTGCTTCGTGGTCGGCGAAGTGAACCTT
CAGGAGCTGTTCGGCCGGGTGGCCGCCGCCATCCACCACGACAGCGCGGGCACGACGCTG
CTGGCCATGCGGGCGGGCATCCCCCAGATCGTGGTGCGCCGCGTAGTGGACAACGTGGTG
GAGCAGGCGTACCACGCCGACCGGGTGGCCGAGCTGGGTGTCGGTGTGGCGGTCGACGGT
CCGGTCCCGACCATCGACTCCTTGTCGGCCGCGCTCGACACGGCTCTGGCCCCGGAGATC
CGTGCGCGAGCGACGACCGTGGCAGACACGATTCGCGCCGATGGGACAACGGTGGCCGCG
CAGCTGCTGTTCGACGCGGTCAGCCTGGAAAAGCCGACTGTTCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-129]  1.4e-25 PF03033
PF03033   Glyco_transf_28
SignalP No significant hit
TMHMM No significant hit