close all open/close all

CDS information : Chlor_00140


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction39,437 / 40,666 / + [in whole cluster]
5,193 / 6,422 / + [in contig]
Location39437..40666 [in whole cluster]
5193..6422 [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)PCZA361.21
GenegtfC
ORF13
Gene (GenBank)
EC number
Keyword
  • L-4-epivancosamine
  • Hpg4
Note
Note (GenBank)
  • similar to glycosyltransferase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[9115410] Production of hybrid glycopeptide antibiotics in vitro and in Streptomyces toyocaensis. (Chem Biol. , 1997)
[11294642] Tandem action of glycosyltransferases in the maturation of vancomycin and teicoplanin aglycones: novel glycopeptides. (Biochemistry. , 2001)
[15070728] Characterization of a regiospecific epivancosaminyl transferase GtfA and enzymatic reconstitution of the antibiotic chloroeremomycin. (Proc Natl Acad Sci U S A. , 2004)
[16045364] A systematic investigation of the synthetic utility of glycopeptide glycosyltransferases. (J Am Chem Soc. , 2005)

close this sectionSequence

selected fasta
>glycosyltransferase [PCZA361.21]
MRVLLSTAGSRGDVEPLVALAVRLQGLGVEARMCASPASAERLAEVGVPHVPVGLQLEGM
LLQEGMPPPSPEEERRLAAKAIDMQFDEVPAAAEGCAAVVAAGELAAAAAVRSVAEMLGI
PYFYAAYSPNYLPSPHHAPPEDERTTPGVTDNKVLWDERGQRFAKRYGDTLNSRRASVGL
PPVEDVFGYGYSERPWLATDPILAPLPPDFDAVQTGTWILPDERPLSAELEAFLAAGSPP
VYLGFGSASGPGIDDAARVAIEAIRAHGRRIVLLSGWADLVRPDDGADCFSVDEVNLQVL
FSRAAAAIHHGSAGTEHLATLAGIPQIVIPRHTDQPYYAERVADLGIGVALEGPVPTFDA
MSAAVATALAPETRARATAVAGTIRTDGAAVAARLLLDAVSREKSAVLA
selected fasta
>glycosyltransferase [PCZA361.21]
ATGCGTGTGTTGTTGTCGACGGCTGGCAGCCGCGGAGACGTCGAACCGCTGGTGGCATTG
GCGGTTCGGCTGCAGGGGCTCGGCGTGGAGGCACGGATGTGCGCATCGCCGGCCTCCGCG
GAGCGGCTGGCCGAGGTAGGTGTGCCGCACGTGCCGGTCGGCCTGCAGCTGGAGGGCATG
CTGTTGCAGGAGGGGATGCCGCCGCCGTCGCCCGAGGAGGAGCGCCGGCTCGCGGCCAAG
GCGATCGACATGCAGTTCGACGAGGTCCCCGCGGCTGCCGAAGGGTGTGCCGCGGTGGTG
GCGGCCGGCGAGCTGGCCGCCGCGGCCGCCGTGCGGTCGGTGGCCGAGATGCTGGGCATT
CCCTACTTCTACGCCGCCTACAGTCCGAACTATCTGCCGTCGCCGCACCACGCGCCGCCC
GAGGACGAGCGGACCACGCCGGGCGTGACCGACAACAAGGTGCTGTGGGACGAGCGTGGC
CAGCGTTTTGCCAAGCGGTACGGGGACACGCTCAACAGCAGGCGGGCCTCGGTCGGCCTG
CCACCGGTTGAGGACGTCTTCGGCTACGGCTACTCCGAGCGGCCCTGGCTGGCGACGGAC
CCGATCCTGGCCCCGCTGCCGCCGGATTTCGACGCCGTGCAGACCGGTACGTGGATCCTG
CCGGACGAACGGCCGCTTTCCGCGGAGCTGGAGGCGTTTCTGGCTGCCGGGTCACCGCCG
GTGTACCTGGGGTTCGGCAGCGCGTCCGGACCTGGCATCGATGACGCCGCGAGGGTGGCC
ATCGAGGCGATCCGTGCCCATGGCCGCCGGATCGTCCTGCTCAGCGGCTGGGCCGACCTG
GTCCGGCCCGACGACGGGGCGGACTGCTTCTCCGTCGACGAAGTGAATCTTCAGGTCCTG
TTCAGCCGGGCGGCCGCCGCCATCCACCACGGCAGCGCGGGCACCGAGCACCTGGCCACG
CTGGCCGGCATCCCGCAGATCGTGATTCCTCGGCACACGGACCAGCCGTACTACGCCGAA
CGAGTGGCTGACCTGGGTATCGGCGTGGCACTCGAGGGTCCGGTCCCGACCTTCGACGCG
ATGTCGGCCGCGGTCGCCACGGCCCTTGCCCCGGAAACCCGCGCGCGTGCGACGGCCGTG
GCAGGCACGATCCGCACCGACGGGGCAGCGGTGGCCGCGCGGTTGCTGCTCGACGCGGTC
AGCCGGGAAAAGTCGGCTGTTCTCGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-134]  2.6e-28 PF03033
PF03033   Glyco_transf_28
SignalP No significant hit
TMHMM No significant hit