close all open/close all

CDS information : Chlor_00150


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction40,739 / 41,965 / + [in whole cluster]
6,495 / 7,721 / + [in contig]
Location40739..41965 [in whole cluster]
6495..7721 [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-3-amino-4-keto-2,3,6-trideoxy-D-glucose C-3 C-methyltransferase
Product (GenBank)PCZA361.22
GeneevaC
ORF14
Gene (GenBank)
EC number2.1.1.-
Keyword
  • L-4-epivancosamine
Note
Note (GenBank)
  • similar to hydroxylase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>dTDP-3-amino-4-keto-2,3,6-trideoxy-D-glucose C-3 C-methyltransferase [PCZA361.22]
MSVTSQCRICDGTVKEFIDFGRQPLSDAFVVPGDEKGEFFFRLATGICDSCTMVQLMEEV
PRDLMFHDAYPYLSSGSAFMRTHFNELAKRLLTTELTGEDPFIVELGCNDGIMLKAMAEA
GVRQLGVEPSGSVADLAAAKGIRVRKDFFEEATAADIRETDGPADVIYAANTLCHIPYMD
SILKGVTTLLGPNGVFVFEDPYLGDIVERTSFDQIYDEHFFFFTARSVQEMAKRNGLELV
DVERIPVHGGEVRYTLALAGARQPTEAVAELLAWEAERKLAEYATLERFATNVKKIKDDL
IALLTKLRAEGKRVVGYGATAKSATVTNFCGITPDLVEFISDTTPAKQNRLSPGQHIPVR
EPKEFAADYPDYALLFAWNHADEIMNAEQAFRDAGGQWILYVPNVHVS
selected fasta
>dTDP-3-amino-4-keto-2,3,6-trideoxy-D-glucose C-3 C-methyltransferase [PCZA361.22]
ATGTCGGTCACGTCCCAGTGCCGTATCTGTGACGGCACTGTCAAAGAGTTCATCGATTTC
GGACGCCAGCCGCTCTCAGACGCGTTCGTCGTTCCCGGCGATGAGAAGGGTGAGTTCTTC
TTCCGGCTCGCCACCGGGATTTGCGATTCCTGCACGATGGTGCAGCTGATGGAAGAAGTC
CCGCGGGACCTGATGTTCCACGACGCGTATCCCTATCTGTCGTCCGGTTCGGCGTTCATG
CGCACGCATTTCAACGAGTTGGCCAAGCGCTTGCTGACCACGGAGCTGACCGGCGAGGAC
CCGTTCATCGTCGAGCTCGGCTGCAACGACGGCATCATGCTCAAGGCCATGGCCGAAGCG
GGTGTGCGCCAGCTCGGCGTCGAACCCTCCGGCAGCGTCGCGGATCTGGCCGCGGCCAAG
GGAATCCGCGTCCGCAAGGACTTCTTCGAAGAGGCGACGGCAGCCGACATCCGCGAGACC
GACGGCCCCGCCGACGTGATCTACGCGGCCAACACCCTGTGCCACATCCCTTACATGGAC
TCGATCCTGAAGGGCGTCACCACGCTGCTGGGCCCGAATGGCGTGTTCGTCTTCGAGGAC
CCGTACCTCGGTGACATCGTGGAGCGCACGTCGTTCGACCAGATCTACGACGAGCATTTC
TTCTTCTTCACCGCACGGTCGGTCCAGGAGATGGCCAAGCGCAACGGTCTTGAGCTCGTC
GACGTCGAGCGCATTCCGGTGCACGGCGGCGAGGTCCGCTACACCCTTGCCCTCGCTGGG
GCTCGTCAGCCGACCGAGGCCGTGGCGGAGCTTCTGGCATGGGAGGCCGAGCGCAAGCTG
GCGGAGTACGCCACGCTGGAACGCTTTGCCACCAACGTGAAGAAGATCAAGGACGACCTG
ATCGCGCTGCTGACCAAGCTGCGCGCCGAGGGCAAGCGCGTCGTCGGCTACGGCGCGACG
GCCAAGAGCGCCACCGTGACCAACTTCTGTGGCATCACCCCGGACCTGGTGGAGTTCATC
TCGGACACCACGCCGGCCAAGCAGAACAGGCTCAGCCCCGGCCAGCACATTCCGGTCCGC
GAGCCCAAGGAGTTCGCCGCCGACTACCCGGACTACGCCCTGCTGTTCGCGTGGAACCAC
GCCGACGAGATCATGAACGCGGAGCAGGCTTTCCGGGACGCCGGTGGGCAGTGGATCCTG
TACGTGCCGAACGTGCACGTGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013630 Methyltransferase putative zinc binding domain (Domain)
 [7-67]  3.7e-20 PF08421
PF08421   Methyltransf_13
IPR013691 C-methyltransferase (Domain)
 [245-403]  1.5e-57 PF08484
PF08484   Methyltransf_14
SignalP No significant hit
TMHMM No significant hit