close all open/close all

CDS information : Chlor_00170


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction42,833 / 43,675 / + [in whole cluster]
8,589 / 9,431 / + [in contig]
Location42833..43675 [in whole cluster]
8589..9431 [in contig]
TypeCDS
Length843 bp (280 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductSAM-dependent N-methyltransferase
Product (GenBank)PCZA361.24
GenemtfA
ORF16
Gene (GenBank)
EC number2.1.1.-
Keyword
  • Leu1
Note
Note (GenBank)
  • similar to methyl transferase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[12596194] Vancomycin assembly: nature's way. (Angew Chem Int Ed Engl. , 2003)
[19389626] Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics. (Chem Biol. , 2009)
Related Reference
ACC
R4T056
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>SAM-dependent N-methyltransferase [PCZA361.24]
MSNQLERGPVRTPHADVLLASVGERGVLCDFYDEGAADTYRDLIQDADGTSEAREFATRT
GPVSGPVLELAAGMGRLTFPFLDLGWEVTALELSTSVLAAFRKRLAEAPADVRDRCTLVQ
GDMSAFALDKRFGTVVISSGSINELDEADRRGLYASVREHLEPGGKFLLSLAMSEAAESE
PLERKQELPGRSGRRYVLHVRHLPAEEIQEITIHPADETTDPFVVCTHRRRLLAPDQVVR
ELVRSGFDVIAQTPFASGGAGRKDMVLVEAVMPGATADAR
selected fasta
>SAM-dependent N-methyltransferase [PCZA361.24]
ATGAGCAATCAACTGGAGCGTGGCCCGGTGCGGACCCCTCACGCCGACGTTCTGCTGGCC
TCGGTAGGTGAGCGAGGCGTGCTGTGCGACTTCTACGACGAGGGCGCCGCGGACACATAT
CGGGATTTGATCCAGGACGCGGACGGCACGTCGGAAGCGCGGGAGTTCGCCACCCGCACA
GGCCCGGTTTCCGGACCTGTGCTGGAGCTGGCGGCTGGAATGGGCCGGCTGACGTTCCCT
TTCCTGGATCTCGGCTGGGAGGTGACCGCCCTGGAACTGTCGACCTCTGTGCTCGCCGCC
TTCCGGAAGCGGTTGGCAGAAGCGCCTGCGGATGTCCGGGATCGGTGCACCCTGGTTCAG
GGAGATATGAGCGCCTTCGCGTTGGACAAGCGCTTCGGAACAGTGGTCATCAGCTCAGGC
TCGATCAACGAACTGGACGAGGCCGACAGGCGTGGCCTGTACGCGTCGGTTCGTGAGCAT
CTCGAGCCTGGCGGGAAGTTCTTGCTCAGCCTGGCCATGTCGGAGGCCGCCGAGTCGGAG
CCGCTGGAGCGCAAGCAAGAGCTGCCAGGCCGCAGCGGCCGACGGTACGTGTTGCACGTC
AGGCATCTGCCGGCGGAAGAGATCCAGGAAATCACCATCCACCCCGCCGACGAAACGACG
GATCCGTTCGTCGTGTGCACGCATCGCAGAAGGCTCCTCGCACCGGATCAGGTAGTGCGC
GAACTTGTGCGGTCCGGCTTCGACGTGATCGCACAGACGCCGTTCGCGTCCGGCGGGGCG
GGCCGTAAGGACATGGTGTTGGTAGAGGCGGTTATGCCCGGGGCCACCGCAGACGCGCGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit