close all open/close all

CDS information : Chlor_00180


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction44,960 / 43,644 / - [in whole cluster]
10,716 / 9,400 / - [in contig]
Locationcomplement(43644..44960) [in whole cluster]
complement(9400..10716) [in contig]
TypeCDS
Length1,317 bp (438 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productaminotransferase
Product (GenBank)PCZA361.25
GenehpgT
ORF17
Gene (GenBank)
EC number2.6.1.-
Keyword
  • Hpg
  • Dpg
Note
Note (GenBank)
  • similar to aminotransferase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
Related Reference
ACC
Q939Y4
NITE
Balhi_00210
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)

close this sectionSequence

selected fasta
>aminotransferase [PCZA361.25]
MEILVFMDSYGLSTQLSMETLHGSLTDPAISSMNLLNELIDEYPVAISMAAGRPYEEFFD
VRLIHEYIDAYCDHLRHDRKLAEAVVTRTLFQYGTTKGIIADLIARNLAEDENIDAAAES
VVVTVGAQEAMFLILRTLRADERDVLLAPAPTYVGLTGAALLTDTPVWPVQSTANGVDPE
DLVLQLKRADEQGKRVRACYVTPNFANPTGTSMDLPARHRLLEVAEANGILLLEDNAYGL
FGSERLPSLKSLDRSGNVVYIGSFAKTGMPGARVGYVVADQRVAGGGLLADQLSKLKGML
TVNTSPIAQAVIAGKLLLNDFSLTKANAREIAIYQRNLQLTLSELERTLGGLPEVGWNTP
TGGFFVTVTVPFVVDDELLAHAARDHGVLFTPMHHFYGGKDGFNQLRLSISLLTPELIKE
GVTRLAALITARLRWPRA
selected fasta
>aminotransferase [PCZA361.25]
ATGGAAATCCTAGTATTCATGGATTCATACGGTCTGTCCACTCAATTGAGCATGGAAACG
CTGCACGGATCGCTCACCGATCCGGCGATCTCATCGATGAACCTGCTGAACGAGTTGATC
GACGAATATCCGGTGGCCATTTCCATGGCGGCAGGCCGGCCGTATGAGGAGTTTTTCGAT
GTCCGGCTCATTCACGAGTACATCGACGCATACTGCGACCATCTCCGGCACGATCGGAAA
CTGGCAGAGGCGGTGGTCACCCGCACGCTTTTCCAGTACGGCACCACGAAAGGCATCATC
GCCGATCTGATCGCCCGCAACCTCGCCGAGGACGAGAACATCGACGCCGCCGCTGAGTCC
GTGGTCGTCACCGTGGGCGCTCAGGAGGCCATGTTCCTGATTCTCCGCACGCTGCGGGCG
GACGAGCGGGACGTGCTGCTCGCCCCCGCTCCCACCTACGTCGGGCTGACCGGGGCGGCG
CTGCTGACCGACACCCCGGTCTGGCCGGTCCAGTCGACCGCGAACGGCGTCGACCCGGAA
GACCTTGTCCTGCAACTGAAACGGGCCGACGAACAAGGCAAGCGGGTCCGGGCCTGTTAC
GTCACACCCAACTTCGCCAACCCGACCGGCACCAGCATGGACCTGCCCGCCCGCCACCGG
CTCCTCGAGGTCGCCGAAGCCAACGGCATCCTTTTGCTGGAGGACAACGCGTACGGGCTC
TTCGGATCCGAACGCCTCCCGTCGCTGAAGTCCCTCGACCGGTCGGGAAACGTGGTCTAC
ATCGGCTCCTTCGCCAAGACCGGCATGCCCGGCGCCCGGGTCGGCTACGTGGTGGCGGAT
CAGCGGGTGGCCGGGGGCGGCCTGCTCGCCGACCAGCTCTCGAAGCTCAAGGGCATGCTC
ACGGTGAACACCTCCCCCATCGCACAGGCGGTGATCGCCGGGAAGCTCCTGCTCAACGAC
TTCAGCCTGACCAAGGCAAACGCCCGCGAGATCGCCATCTACCAGCGAAACCTCCAGCTC
ACGCTGAGCGAACTGGAGCGCACGCTCGGCGGCCTGCCCGAGGTCGGCTGGAACACGCCG
ACGGGCGGCTTCTTCGTCACCGTCACCGTGCCCTTCGTCGTCGACGACGAACTGCTGGCA
CATGCCGCCCGCGACCATGGCGTGCTGTTCACCCCGATGCATCACTTCTACGGCGGCAAG
GACGGGTTCAATCAGCTCCGGCTGTCGATCAGTCTGCTCACGCCGGAGCTGATCAAGGAG
GGCGTGACCCGGCTTGCCGCGCTCATCACCGCGCGTCTGCGGTGGCCCCGGGCATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004839 Aminotransferase, class I/classII (Domain)
 [85-425]  1.99999999999999e-31 PF00155
PF00155   Aminotran_1_2
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [80-305]  4.6e-44 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [306-429]  2.7e-07 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [7-429]  6.90004508941104e-75 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit