close all open/close all

CDS information : Chlor_00190


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction45,178 / 46,008 / + [in whole cluster]
10,934 / 11,764 / + [in contig]
Location45178..46008 [in whole cluster]
10934..11764 [in contig]
TypeCDS
Length831 bp (276 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative thioesterase
Product (GenBank)PCZA361.30
GenecepJ
ORF18
Gene (GenBank)
EC number
Keyword
  • Bht
  • unusual type
Note
Note (GenBank)
  • similar to haloperoxidase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[12596194] Vancomycin assembly: nature's way. (Angew Chem Int Ed Engl. , 2003)
Related Reference
ACC
Q939Y3
NITE
Balhi_00220
PmId
[11880037] Glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908: function of a halogenase and a haloperoxidase/perhydrolase. (Chem Biol. , 2002)
[19998400] The thioesterase Bhp is involved in the formation of beta-hydroxytyrosine during balhimycin biosynthesis in Amycolatopsis balhimycina. (Chembiochem. , 2010)

close this sectionSequence

selected fasta
>putative thioesterase [PCZA361.30]
MLMTTETGIRLSYHDHGDGSPVLLLTGTGAPSSVWDLHQVPVLRAAGFRVITMDNRGIPP
SDEGTDGFTIDDLVADVAALIEHLGVAPCRVVGTSMGSYIAQELALAHPELLDAVVLMAA
CGRSSLVQRVLAEGEAKLIELGTELPPGYLAAVRAMHNLGPATLADDDLTGDWLDLFEAS
DNWGPGVRAQLQLSALPDRIDAYRAIKVPCHVISFEHDLVAPPSAGRELAAAIPGATHRT
IPGCGHFGYLENPEAVNRELLRFLRAESAARLEETA
selected fasta
>putative thioesterase [PCZA361.30]
ATGCTGATGACAACTGAGACCGGGATCCGGTTGTCGTACCACGACCATGGCGACGGTTCG
CCTGTCCTGTTGCTGACCGGCACCGGGGCGCCGAGCTCGGTATGGGACCTGCACCAGGTG
CCCGTGCTGCGCGCCGCCGGGTTCCGGGTGATCACCATGGACAACCGTGGCATCCCGCCA
AGCGACGAAGGCACGGACGGGTTCACCATCGACGACCTCGTCGCGGACGTGGCCGCCCTG
ATCGAGCACCTCGGTGTGGCGCCGTGCCGCGTGGTCGGCACCTCGATGGGCTCGTACATC
GCACAGGAGCTGGCACTCGCGCACCCGGAGCTGCTGGACGCGGTCGTGCTCATGGCGGCC
TGCGGCAGGAGCAGCCTCGTCCAGCGGGTGCTCGCGGAGGGCGAGGCGAAGCTGATCGAA
CTGGGCACCGAGCTGCCACCGGGCTACCTCGCCGCCGTTCGCGCCATGCACAACCTCGGG
CCCGCGACGCTCGCCGACGACGACCTCACCGGCGACTGGCTTGACTTGTTCGAGGCGTCG
GACAACTGGGGTCCGGGAGTTCGGGCGCAGCTGCAGCTGAGCGCGTTGCCCGACCGCATC
GACGCCTACCGTGCGATCAAAGTGCCCTGCCACGTCATCTCGTTCGAGCACGACCTCGTG
GCGCCCCCGTCAGCTGGACGGGAGCTGGCCGCCGCGATTCCCGGCGCCACGCACCGCACC
ATCCCCGGTTGCGGGCACTTCGGCTACTTGGAGAACCCGGAAGCGGTGAACCGTGAGCTG
CTCCGGTTCCTCCGCGCCGAGTCCGCCGCGCGACTGGAGGAGACCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [47-62]  1.30000067202732e-06 PR00111 [91-104]  1.30000067202732e-06 PR00111 [105-118]  1.30000067202732e-06 PR00111
PR00111   ABHYDROLASE
IPR000639 Epoxide hydrolase-like (Family)
 [47-62]  9.30000048475975e-08 PR00412 [208-224]  9.30000048475975e-08 PR00412 [241-263]  9.30000048475975e-08 PR00412
PR00412   EPOXHYDRLASE
SignalP No significant hit
TMHMM No significant hit