close all open/close all

CDS information : Chlor_00200


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction46,005 / 47,747 / + [in whole cluster]
11,761 / 13,503 / + [in contig]
Location46005..47747 [in whole cluster]
11761..13503 [in contig]
TypeCDS
Length1,743 bp (580 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative L-tyrosine--PCP ligase/peptidyl carrier protein
putative L-tyrosyl-PCP synthetase/peptidyl carrier protein
Product (GenBank)PCZA361.18
GenecepK
ORF19
Gene (GenBank)
EC number
Keyword
  • Bht
Note
Note (GenBank)
  • similar to peptide synthetase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[12596194] Vancomycin assembly: nature's way. (Angew Chem Int Ed Engl. , 2003)
[21890635] Role of MbtH-like proteins in the adenylation of tyrosine during aminocoumarin and vancomycin biosynthesis. (J Biol Chem. , 2011)
Related Reference
ACC
Q939Y2
NITE
Balhi_00230
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)
[20519494] Structural characterization of OxyD, a cytochrome P450 involved in beta-hydroxytyrosine formation in vancomycin biosynthesis. (J Biol Chem. , 2010)

close this sectionPKS/NRPS Module

B1 tyrosine
A36..428
PCP509..576

close this sectionSequence

selected fasta
>putative L-tyrosine--PCP ligase/peptidyl carrier protein [PCZA361.18]
MTGEAQPPSTAPALFEATAAAVPDRPAVAMGTTTLTYAELNGEANLLAHRLVEHGVGPEK
LVALAMPRSVEFVIAILAVHKAGAAYVPVDPDYPEDRRRHMLDDTSAHCLLALPGQDVAG
APVVMSVERQAGLSAPNLTDQDRLGPLLPDHPAYVIYTSGSTGQPKGVLVTHRGIPNLAD
DYVRRQNLVPDSRLLAFASPSFDAAVAEFWPIWLAGGCLVLAPASDLIPGEPLARLVRDQ
RITHVTLPPSALAPLEEGGGLPPGLTLLVAGEACPAPVAKSWARDRVMINAYGPTEATVA
VTASDPLTGEGTPPIGRPITGVSTYILDDRLHPVPDGDVGELYMTGPGLARGYLRRPAAT
AERFLPNPFGGPGERMYRTGDRVWAGSDGQLVFVGRVDDQLKVRGHRIEPGEVESALLAV
DGVAQAVVTEHDNRLVAYVVGAGGARVAAEDLLPPLRKQLPGYLVPDVVVGLPRLPTSPN
GKVDRAALPDPDADGAERATSGRAPSTPTEIRLAELFAEVLSVSSVGVDDSFFDIGGHSL
LATRLVARIRESLQVRLRVQAFFNAPSVAQLAKVLDGAST
selected fasta
>putative L-tyrosine--PCP ligase/peptidyl carrier protein [PCZA361.18]
ATGACCGGCGAGGCACAGCCGCCATCCACTGCGCCCGCGTTGTTCGAGGCGACCGCCGCC
GCGGTGCCGGACCGGCCGGCCGTGGCGATGGGAACCACCACGCTGACCTACGCAGAGCTG
AACGGGGAGGCCAATCTCCTCGCGCACAGGCTCGTCGAGCACGGGGTGGGCCCGGAAAAG
CTTGTCGCACTGGCGATGCCGCGGTCGGTCGAGTTCGTCATCGCGATCCTGGCCGTGCAC
AAGGCAGGTGCCGCGTACGTGCCCGTCGACCCGGACTATCCGGAGGACCGCAGGCGGCAC
ATGCTCGACGACACCTCAGCGCATTGTCTTTTGGCCCTGCCCGGGCAGGATGTGGCCGGT
GCGCCGGTTGTGATGAGCGTGGAACGTCAGGCAGGCCTGTCCGCGCCGAACCTGACCGAC
CAGGACCGGCTCGGCCCGTTGCTTCCCGATCACCCCGCGTACGTCATCTACACGTCGGGC
TCGACTGGGCAGCCGAAAGGCGTACTGGTCACGCACCGCGGCATCCCGAACCTGGCCGAC
GACTACGTGCGCCGCCAGAACCTGGTGCCGGACAGCAGGTTGCTGGCTTTCGCGTCACCT
AGCTTCGACGCCGCCGTCGCCGAGTTCTGGCCGATCTGGCTGGCCGGTGGCTGCCTGGTG
CTTGCTCCCGCGTCGGACCTGATCCCCGGCGAGCCGCTCGCCCGGCTGGTGCGCGACCAG
CGGATCACCCACGTCACGTTGCCGCCGTCCGCACTGGCACCGCTCGAGGAAGGCGGCGGC
CTGCCCCCGGGACTGACCCTCTTGGTCGCGGGCGAGGCGTGCCCGGCTCCGGTCGCGAAA
AGCTGGGCACGCGACCGCGTCATGATCAACGCGTACGGCCCGACCGAGGCCACGGTCGCG
GTGACCGCGAGCGACCCGCTGACCGGCGAAGGCACGCCGCCGATCGGCAGGCCGATCACC
GGCGTGAGCACGTACATCCTGGACGACCGGCTGCACCCCGTTCCGGACGGGGACGTGGGC
GAGCTGTACATGACCGGCCCTGGCCTTGCCCGCGGTTACCTGCGCAGACCGGCCGCGACC
GCGGAGCGGTTCCTGCCGAATCCCTTCGGTGGCCCGGGTGAGCGCATGTACCGCACCGGC
GACCGGGTGTGGGCGGGTTCGGACGGGCAGCTCGTGTTCGTCGGCCGCGTCGACGACCAG
CTGAAGGTTCGTGGTCACCGGATCGAGCCGGGCGAGGTCGAGTCCGCGCTGCTCGCGGTG
GATGGCGTGGCCCAGGCGGTGGTGACCGAGCACGACAACCGGCTCGTCGCTTATGTGGTG
GGCGCCGGCGGGGCGCGGGTGGCAGCCGAAGACCTCCTGCCGCCGCTGCGCAAGCAGCTG
CCCGGCTACCTCGTACCGGACGTGGTCGTCGGCTTGCCGCGCCTGCCGACGTCGCCGAAC
GGCAAGGTCGACCGGGCCGCCTTGCCCGATCCCGATGCGGACGGCGCCGAGCGCGCGACC
TCGGGGCGAGCACCGAGCACACCGACCGAGATCCGCCTGGCCGAGTTGTTCGCCGAAGTG
CTCAGCGTCAGCAGCGTCGGCGTCGACGACAGCTTCTTCGACATCGGCGGCCACTCGCTG
CTCGCGACTCGGCTGGTGGCCCGCATCCGGGAAAGCCTGCAGGTCCGGCTGCGCGTGCAG
GCCTTCTTCAACGCGCCGTCCGTGGCACAGCTGGCCAAGGTGCTCGACGGCGCATCGACG
TGA
[1] A36..428
[1] tyrosine203..300
[1] PCP509..576
[1] A106..1284
[1] tyrosine607..900
[1] PCP1525..1728

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [36-428]  1.29999999999998e-110 PF00501
PF00501   AMP-binding
IPR006162 Phosphopantetheine attachment site (PTM)
 [534-549]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [502-577]  3.69999438558106e-20 SSF47336
SSF47336   ACP_like
 [500-577]  4.29999999999998e-27 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [509-576]  PS50075
PS50075   ACP_DOMAIN
 [512-573]  1.1e-13 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [36-428]  1.29999999999998e-126 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020459 AMP-binding (Domain)
 [150-161]  8.80000265836278e-05 PR00154 [162-170]  8.80000265836278e-05 PR00154
PR00154   AMPBINDING
IPR020845 AMP-binding, conserved site (Conserved_site)
 [155-166]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit