close all open/close all

CDS information : Chlor_00210


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction47,763 / 48,956 / + [in whole cluster]
13,519 / 14,712 / + [in contig]
Location47763..48956 [in whole cluster]
13519..14712 [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative cytochrome P450
Product (GenBank)PCZA361.17
GenecepL
ORF20
Gene (GenBank)
EC number
Keyword
  • Bht
Note
Note (GenBank)
  • similar to P450 related oxidase/hydroxylase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[12596194] Vancomycin assembly: nature's way. (Angew Chem Int Ed Engl. , 2003)
Related Reference
ACC
Q939Y1
NITE
Balhi_00240
PmId
[15342578] Biosynthesis of chloro-beta-hydroxytyrosine, a nonproteinogenic amino acid of the peptidic backbone of glycopeptide antibiotics. (J Bacteriol. , 2004)
[20519494] Structural characterization of OxyD, a cytochrome P450 involved in beta-hydroxytyrosine formation in vancomycin biosynthesis. (J Biol Chem. , 2010)

close this sectionSequence

selected fasta
>putative cytochrome P450 [PCZA361.17]
MQTTTAVGDLGNPDLYTTLDRHARWRELAARDAMVWSEPGSSPTGFWSVFSHRACAAVLA
PSAPFTSEYGMMIGFDRDHPDKSGGQMMVVSEQEQHRKLRRLVGPLLSRAAARKLSERVR
TEVSGVLDQVLDGGVCDVATAIGPRIPAAVVCEILGVPAEDEDMLIELTNHAFGGEDELF
DGMTPRQAHTEILVYFDELITARRERPADDLVSTLVTDDELTIDDVLLNCDNVLIGGNET
TRHAITGAVHALATVPGLLTGLQDGSADVDTVVEEVLRWTSPAMHVLRVSTDDVTINGQD
LPAGTPVVAWLPAANRDPAEFDDPDTFLPGRKPNRHITFGHGMHHCLGSALARIELSVVL
RVLAERVSRVELVKEPAWLRAIVVQGYAELSARFTGR
selected fasta
>putative cytochrome P450 [PCZA361.17]
ATGCAGACGACGACAGCCGTCGGTGATCTCGGTAACCCGGATCTGTACACGACCTTGGAC
CGGCACGCCCGCTGGCGCGAGCTGGCCGCGCGGGACGCGATGGTGTGGAGTGAACCGGGC
AGTTCACCCACCGGTTTCTGGTCGGTGTTCTCGCACCGGGCGTGCGCCGCGGTCCTCGCG
CCCTCGGCGCCGTTCACCTCCGAGTACGGAATGATGATCGGGTTCGACCGTGACCACCCG
GACAAGTCGGGCGGTCAGATGATGGTGGTCTCCGAGCAGGAGCAGCACCGCAAACTGCGC
AGGCTGGTCGGGCCGCTGTTGTCCAGGGCGGCTGCCCGCAAGCTGTCGGAGCGGGTGCGC
ACCGAGGTCAGCGGCGTGCTGGACCAGGTGCTCGACGGCGGCGTGTGCGACGTGGCGACG
GCGATCGGCCCGCGCATTCCCGCCGCGGTCGTGTGCGAGATCCTCGGTGTGCCCGCCGAG
GACGAGGACATGCTCATCGAGCTGACCAACCACGCGTTCGGCGGTGAGGACGAGCTGTTC
GACGGGATGACGCCACGCCAGGCGCACACCGAGATCCTCGTCTACTTCGACGAACTGATC
ACCGCGCGCCGCGAGCGTCCCGCCGACGACCTCGTCAGCACGCTGGTGACCGATGACGAG
CTCACGATCGACGACGTGTTGCTCAACTGCGACAACGTGTTGATCGGCGGGAACGAGACC
ACGCGGCACGCGATCACCGGTGCGGTGCACGCCCTCGCCACGGTGCCCGGCCTGCTGACC
GGGCTGCAAGACGGGAGCGCCGACGTCGACACCGTCGTGGAGGAGGTGCTGCGCTGGACC
TCGCCGGCGATGCACGTCCTGCGGGTGTCGACCGACGATGTCACGATCAACGGCCAGGAC
CTGCCGGCAGGCACACCGGTGGTCGCGTGGTTGCCCGCCGCGAACAGGGATCCCGCCGAG
TTCGACGACCCCGACACGTTCCTCCCAGGGCGGAAACCCAACCGCCACATCACCTTCGGC
CACGGTATGCACCACTGCCTCGGGTCCGCGCTGGCGCGGATCGAGCTGTCGGTCGTGTTG
CGAGTGCTGGCCGAGCGGGTGTCGCGGGTGGAGCTGGTGAAGGAGCCTGCCTGGCTGCGC
GCGATCGTCGTGCAGGGGTACGCGGAGCTTTCGGCGCGGTTCACCGGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [270-361]  1.8e-19 PF00067
PF00067   p450
 [10-397]  3.89999861795218e-84 SSF48264
SSF48264   Cytochrome_P450
 [236-253]  4.19999771339581e-06 PR00385 [271-282]  4.19999771339581e-06 PR00385 [337-346]  4.19999771339581e-06 PR00385 [346-357]  4.19999771339581e-06 PR00385
PR00385   P450
 [18-397]  1e-92 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [91-102]  1.70000295590053e-46 PR00359 [137-153]  1.70000295590053e-46 PR00359 [154-169]  1.70000295590053e-46 PR00359 [194-216]  1.70000295590053e-46 PR00359 [271-282]  1.70000295590053e-46 PR00359 [288-315]  1.70000295590053e-46 PR00359 [316-331]  1.70000295590053e-46 PR00359 [337-346]  1.70000295590053e-46 PR00359 [346-357]  1.70000295590053e-46 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [339-348]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit