close all open/close all

CDS information : Chlor_00220


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction49,201 / 50,274 / + [in whole cluster]
14,957 / 16,030 / + [in contig]
Location49201..50274 [in whole cluster]
14957..16030 [in contig]
TypeCDS
Length1,074 bp (357 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Product4-hydroxymandelate synthase
Product (GenBank)PCZA361.1
GenehmaS
ORF21
Gene (GenBank)
EC number1.13.11.46
Keyword
  • Hpg
Note
Note (GenBank)
  • similar to hydroxyphenyl pyruvate dioxygenase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[18215022] Two roads diverged: the structure of hydroxymandelate synthase from Amycolatopsis orientalis in complex with 4-hydroxymandelate. (Biochemistry. , 2008)

close this sectionSequence

selected fasta
>4-hydroxymandelate synthase [PCZA361.1]
MQNFEIDYVEMYVENLEVAAFSWVDKYAFAVAGTSRSADHRSIALRQGQVTLVLTEPTSD
RHPAAAYLQTHGDGVADIAMATSDVAAAYEAAVRAGAEAVRAPGQHSEAAVTTATIGGFG
DVVHTLIQRDGTSAELPPGFTGSMDVTNHGKGDVDLLGIDHFAICLNAGDLGPTVEYYER
ALGFRQIFDEHIVVGAQAMNSTVVQSASGAVTLTLIEPDRNADPGQIDEFLKDHQGAGVQ
HIAFNSNDAVRAVKALSERGVEFLKTPGAYYDLLGERITLQTHSLDDLRATNVLADEDHG
GQLFQIFTASTHPRHTIFFEVIERQGAGTFGSSNIKALYEAVELERTGQSEFGAARR
selected fasta
>4-hydroxymandelate synthase [PCZA361.1]
ATGCAGAATTTCGAGATCGACTACGTAGAAATGTATGTGGAAAATCTTGAGGTGGCTGCG
TTCAGCTGGGTGGACAAGTACGCGTTCGCCGTCGCCGGTACCAGCCGGTCGGCGGACCAC
CGGAGCATCGCGCTACGGCAGGGGCAGGTGACGCTGGTCCTCACCGAGCCCACGTCGGAT
CGTCACCCGGCGGCGGCCTACCTCCAGACGCACGGCGACGGTGTCGCCGACATCGCGATG
GCCACTTCGGACGTCGCCGCCGCTTACGAGGCCGCGGTGCGGGCGGGGGCGGAAGCCGTC
CGCGCGCCGGGGCAGCACTCGGAGGCCGCGGTCACGACGGCCACCATCGGTGGTTTCGGC
GATGTCGTGCACACCCTGATTCAGCGCGACGGAACATCCGCCGAGCTGCCCCCGGGCTTC
ACCGGCTCGATGGACGTCACCAACCACGGCAAGGGAGATGTCGACCTGCTCGGCATCGAC
CACTTCGCGATCTGCCTGAACGCCGGCGACCTCGGCCCCACGGTGGAGTACTACGAGCGG
GCACTGGGTTTCCGGCAGATCTTCGACGAGCACATCGTGGTCGGTGCGCAGGCGATGAAC
TCCACCGTCGTGCAGAGTGCGTCCGGAGCGGTCACCCTCACCCTGATCGAGCCCGACCGG
AACGCCGACCCCGGCCAGATCGACGAGTTCCTCAAGGATCACCAAGGGGCAGGCGTTCAG
CACATCGCCTTCAACAGCAACGACGCGGTCCGTGCGGTCAAGGCGCTGTCCGAGCGCGGG
GTGGAGTTCCTCAAGACGCCGGGGGCCTACTACGACCTGCTCGGTGAGCGGATCACGCTG
CAGACGCACTCGCTGGACGATCTGCGGGCGACGAACGTGCTCGCCGATGAGGACCACGGC
GGCCAGCTGTTCCAGATCTTCACCGCGTCCACTCATCCGCGTCACACGATTTTCTTCGAG
GTCATCGAGCGGCAGGGCGCGGGCACCTTCGGCAGCTCCAACATCAAGGCCCTGTACGAG
GCCGTTGAGCTGGAACGCACCGGGCAGAGCGAGTTCGGCGCCGCTCGGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004360 Glyoxalase/fosfomycin resistance/dioxygenase domain (Domain)
 [158-306]  7.4e-19 PF00903
PF00903   Glyoxalase
IPR005956 4-hydroxyphenylpyruvate dioxygenase (Family)
 [5-350]  9.49999999999983e-124 TIGR01263
TIGR01263   4HPPD
 [1-351]  PIRSF009283
PIRSF009283   HPP_dOase
SignalP No significant hit
TMHMM No significant hit