close all open/close all

CDS information : Chlor_00230


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction50,271 / 51,344 / + [in whole cluster]
16,027 / 17,100 / + [in contig]
Location50271..51344 [in whole cluster]
16027..17100 [in contig]
TypeCDS
Length1,074 bp (357 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Product4-hydroxymandelate oxidase
Product (GenBank)PCZA361.2
Genehmo
ORF22
Gene (GenBank)
EC number1.1.3.46
Keyword
  • Hpg
Note
Note (GenBank)
  • similar to glycolate oxidase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[12240298] Characterisation of a hydroxymandelate oxidase involved in the biosynthesis of two unusual amino acids occurring in the vancomycin group of antibiotics. (Chem Commun (Camb). , 2001)

close this sectionSequence

selected fasta
>4-hydroxymandelate oxidase [PCZA361.2]
MTYVSLADLERAARDVLPGEIFDFLAGGSGTEASLVANRTALERVFVIPRMLRDLTDVTT
EIDIFGRRAALPMAVAPVAYQRLFHPEGELAVARAARDAGVPYTICTLSSVSLEEIAAVG
GRPWFQLYWLRDEKRSLDLVRRAEDAGCEAIVFTVDVPWMGRRLRDMRNGFALPEWVTAA
NFDAGTAAHRRTQGVSAVADHTAREFAPATWESVEAVRAHTDLPVVLKGILAVEDARRAV
DAGAGGIVVSNHGGRQLDGAVPGIEMLGEIVAAVSGGCEVLVDGGIRSGGDVLKATALGA
SAVLVGRPVMWALAAAGQDGVRQLLELLAEEVRDAMGLAGCESVGAARRLNTKLGVV
selected fasta
>4-hydroxymandelate oxidase [PCZA361.2]
ATGACGTACGTTTCCCTGGCCGACCTCGAACGTGCCGCCCGGGATGTCCTGCCCGGCGAG
ATCTTCGACTTTCTCGCTGGGGGTAGCGGCACCGAGGCGTCTCTGGTGGCCAACCGCACC
GCGCTGGAGCGGGTCTTCGTGATCCCCCGGATGCTGCGTGACCTGACGGACGTCACCACC
GAGATCGACATCTTCGGCCGGCGCGCCGCGCTGCCGATGGCGGTCGCACCGGTCGCGTAC
CAGCGGTTGTTCCATCCGGAGGGCGAGCTCGCAGTGGCTCGCGCGGCCAGGGACGCCGGC
GTGCCGTACACCATCTGCACGCTGAGCAGCGTTTCGCTGGAGGAGATCGCGGCCGTCGGC
GGCCGGCCGTGGTTCCAGCTGTACTGGCTGCGGGATGAGAAGCGGTCTCTGGACCTTGTC
CGCCGCGCGGAGGACGCAGGCTGCGAGGCGATCGTGTTCACCGTCGACGTGCCGTGGATG
GGCAGGCGGTTGCGGGACATGCGCAACGGCTTCGCGTTGCCGGAGTGGGTGACGGCGGCC
AACTTCGACGCCGGAACGGCCGCACACCGCCGTACCCAAGGGGTTTCGGCCGTCGCCGAC
CACACCGCGCGCGAATTCGCCCCGGCCACATGGGAATCCGTGGAGGCGGTCCGCGCGCAC
ACGGACCTTCCAGTGGTGCTCAAGGGGATCCTCGCGGTCGAGGACGCCCGTCGCGCCGTC
GACGCGGGTGCAGGCGGAATCGTGGTGTCCAACCACGGAGGTCGTCAGTTGGACGGTGCC
GTGCCCGGAATCGAGATGCTGGGCGAGATCGTCGCCGCGGTCTCCGGCGGCTGCGAGGTG
TTGGTGGACGGGGGAATCCGCAGTGGCGGGGACGTCCTCAAGGCGACCGCTCTCGGTGCG
TCGGCCGTGCTGGTCGGGCGGCCGGTGATGTGGGCGCTGGCCGCGGCAGGCCAGGACGGC
GTTCGGCAGCTGCTCGAACTGCTCGCCGAAGAAGTTCGCGACGCGATGGGCCTGGCGGGT
TGCGAGTCGGTGGGCGCGGCTCGCCGGCTGAACACGAAACTGGGGGTTGTTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000262 FMN-dependent dehydrogenase (Domain)
 [13-348]  4.49999999999996e-122 PF01070
PF01070   FMN_dh
IPR008259 FMN-dependent alpha-hydroxy acid dehydrogenase, active site (Active_site)
 [250-256]  PS00557
PS00557   FMN_HYDROXY_ACID_DH_1
IPR012133 Alpha-hydroxy acid dehydrogenase, FMN-dependent (Family)
 [1-357]  PS51349
PS51349   FMN_HYDROXY_ACID_DH_2
 [1-354]  PIRSF000138
PIRSF000138   Al-hdrx_acd_dh
IPR013785 Aldolase-type TIM barrel (Domain)
 [3-349]  7.40000000000006e-129 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit