close all open/close all

CDS information : Chlor_00240


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction51,344 / 52,759 / + [in whole cluster]
17,100 / 18,515 / + [in contig]
Location51344..52759 [in whole cluster]
17100..18515 [in contig]
TypeCDS
Length1,416 bp (471 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase
Product (GenBank)PCZA361.3
GeneevaA
ORF23
Gene (GenBank)
EC number
Keyword
  • L-4-epivancosamine
Note
Note (GenBank)
  • similar to sugar biosynthesis gene
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)
[23473392] Structure of EvaA: a paradigm for sugar 2,3-dehydratases. (Biochemistry. , 2013)

close this sectionSequence

selected fasta
>dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [PCZA361.3]
MSSFVVPSLTAVRPRDHHDYADRIALSAATTDGVQMRTEDVRAWIAERRDANVFHVERIP
FADLDQWWFEGVTGNLVHRSGRFFTIEGLHVIEHDGPHGDGPYREWQQPVIRQPEVGILG
ILAKEFDGVLHFLMQAKMEPGNPNLVQLSPTVQATRSNYTKAHGGTNVKLIEYFAPPDPE
RVIVDVLQAEQGSWFFRKSNRNMIVETVDDVPLWDDFCWLTLGQIAELMHEDETINMNSR
SVLSCLPYQDITPRALFSDVQLLSWFTNERSRHDVRVRRIPLADVCGWKQGAEEIEHEDG
RYFKVLAVAVKGSNREKISWTQPLVESVDLGVVAFLVRKIDGVPHVLVQARVDGGFLDTV
ELAPTVQCTPLNYAHLPAEERPPFLDLVQNAPRSRIRYEAIHSEEGGRFLGVRARYLVID
ADEAIDPPPGYAWVTPAQLTALTRHGHYVNVEARTLLACINAAAAQPRGGA
selected fasta
>dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [PCZA361.3]
ATGTCGTCCTTCGTCGTTCCATCACTCACCGCGGTGCGCCCTCGTGACCACCACGACTAC
GCCGACCGCATCGCCTTGTCGGCCGCGACCACCGATGGGGTACAGATGCGGACCGAGGAT
GTCCGCGCCTGGATCGCCGAACGCCGCGACGCCAACGTCTTCCACGTCGAACGAATCCCG
TTCGCCGACCTGGACCAGTGGTGGTTCGAAGGCGTGACCGGCAATCTGGTGCACCGCAGC
GGGCGGTTCTTCACCATCGAGGGCCTGCACGTGATCGAGCACGACGGCCCGCACGGCGAC
GGCCCGTACCGCGAGTGGCAGCAGCCGGTCATCAGGCAGCCCGAAGTGGGCATCCTCGGC
ATCCTGGCCAAGGAGTTCGACGGGGTGCTGCACTTCCTGATGCAGGCCAAGATGGAGCCG
GGCAACCCCAACCTGGTGCAGCTCTCGCCGACCGTGCAGGCCACCCGGAGCAACTACACC
AAGGCGCACGGCGGTACGAACGTCAAGCTGATCGAGTACTTCGCGCCGCCGGACCCCGAG
CGGGTCATCGTCGACGTTCTCCAGGCGGAGCAAGGATCCTGGTTCTTCCGCAAGTCCAAT
CGCAACATGATCGTCGAGACCGTCGACGACGTGCCGTTGTGGGACGACTTCTGCTGGCTC
ACCCTCGGCCAGATCGCCGAACTGATGCACGAGGACGAGACGATCAACATGAACTCCCGA
AGCGTGTTGTCGTGTCTGCCCTACCAGGACATAACTCCTCGCGCGCTGTTCTCCGACGTT
CAGCTCCTGTCGTGGTTCACCAACGAGCGTTCGCGTCACGATGTGCGCGTCCGCCGCATT
CCGCTCGCGGACGTGTGCGGCTGGAAGCAAGGCGCCGAGGAGATCGAGCACGAGGACGGC
CGTTACTTCAAGGTCCTCGCGGTCGCCGTGAAAGGCAGCAACCGCGAGAAGATCAGTTGG
ACCCAGCCGTTGGTCGAATCCGTCGACTTGGGTGTCGTCGCGTTCCTCGTGCGGAAGATC
GACGGTGTGCCGCACGTTCTGGTGCAGGCCCGCGTTGACGGTGGTTTCCTGGACACGGTC
GAGTTGGCGCCGACCGTCCAGTGCACGCCCCTCAACTACGCACACCTGCCCGCGGAGGAG
CGTCCGCCGTTCCTTGACCTCGTCCAGAACGCACCCCGGTCGCGAATCCGTTACGAGGCG
ATCCATTCCGAAGAAGGCGGCCGCTTCCTCGGCGTCCGGGCCCGATATCTCGTGATCGAC
GCGGACGAGGCAATCGATCCACCGCCTGGCTACGCCTGGGTCACCCCGGCGCAGCTCACC
GCGCTCACCCGGCACGGGCACTACGTCAACGTCGAGGCTCGCACGCTTCTCGCGTGCATC
AACGCCGCGGCGGCCCAGCCTCGGGGAGGTGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [37-246]  3.49999999999995e-82 PF03559 [259-460]  1.5e-83 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit