close all open/close all

CDS information : Chlor_00250


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction52,761 / 53,738 / + [in whole cluster]
18,517 / 19,494 / + [in contig]
Location52761..53738 [in whole cluster]
18517..19494 [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-hexose C-4 ketoreductase
Product (GenBank)PCZA361.4
GeneevaE
ORF24
Gene (GenBank)
EC number
Keyword
  • L-4-epivancosamine
  • equatorial-OH
Note
Note (GenBank)
  • similar to dTDP-dehydrogenase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>dTDP-hexose C-4 ketoreductase [PCZA361.4]
MKLITVLGASGFIGSAVTRALAQQPIRLRAVARRQFTPAPGQAETTVVAADLTDRVALAD
AVAGSDAVVYLLLSDGGWRAVETEDAERVNVGVMRDLIDVTGSDNGTPPVVVFGGTVSQV
GVPPREPLDGSEPDNPATPYDIQKLTAEQILKKATANGQVRGISLRLPTIFGETTAQGAN
HDRGVVSSMARRALDGQALTIWGDGSVRRDVVHVEDVAAAFTAALANPDSLVGGHWLIGA
GRGDQLGEIFRLVAREVAEQTGQRPVEVTCVEPPSHAPEMDFRSVTIDSSPFRAVTGWRP
EISLSEGVRRTVAALTTSVHGKARA
selected fasta
>dTDP-hexose C-4 ketoreductase [PCZA361.4]
ATGAAGCTGATCACCGTGCTCGGTGCGTCGGGCTTCATCGGCTCGGCTGTCACGCGTGCA
CTGGCGCAGCAGCCAATCCGGCTGCGAGCGGTGGCGCGCAGGCAGTTCACGCCCGCGCCC
GGCCAAGCCGAGACGACCGTCGTCGCCGCTGATCTCACCGACCGTGTCGCGCTCGCCGAC
GCGGTCGCGGGATCGGACGCGGTCGTGTACCTGCTTCTGTCAGACGGCGGATGGCGCGCG
GTCGAGACCGAGGACGCCGAACGCGTGAACGTGGGCGTCATGCGGGACCTCATCGACGTC
ACCGGCAGCGACAACGGGACGCCCCCGGTGGTGGTGTTCGGCGGTACCGTCTCGCAGGTC
GGTGTGCCACCTCGGGAGCCGCTCGACGGCAGCGAGCCCGACAACCCGGCGACTCCCTAC
GACATACAGAAGCTGACAGCGGAACAGATCCTCAAGAAGGCCACGGCAAATGGCCAGGTG
CGCGGCATCAGCCTGCGTCTGCCGACGATATTCGGTGAAACCACGGCACAAGGCGCGAAC
CACGACCGCGGTGTCGTGTCGTCCATGGCGCGGCGAGCGCTCGACGGCCAGGCACTCACC
ATCTGGGGCGACGGCAGCGTGCGACGCGACGTCGTCCATGTCGAGGACGTCGCGGCGGCG
TTCACCGCGGCACTGGCCAACCCGGATTCCCTTGTCGGCGGCCACTGGCTGATCGGCGCG
GGCCGAGGCGATCAGCTTGGGGAGATTTTCCGCCTCGTGGCACGGGAAGTGGCCGAGCAG
ACCGGGCAGCGCCCGGTCGAGGTGACCTGTGTGGAACCACCGTCGCACGCACCTGAGATG
GATTTCCGCAGCGTCACCATCGATTCCTCGCCGTTCCGGGCGGTCACCGGCTGGCGCCCA
GAGATTTCGCTGTCCGAAGGAGTGCGTCGCACTGTCGCCGCATTGACGACATCAGTTCAT
GGAAAGGCTCGCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-239]  1.6e-48 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [4-191]  5.69999999999998e-24 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit