close all open/close all

CDS information : Chlor_00260


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction53,735 / 54,844 / + [in whole cluster]
19,491 / 20,600 / + [in contig]
Location53735..54844 [in whole cluster]
19491..20600 [in contig]
TypeCDS
Length1,110 bp (369 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-hexose C-3 aminotransferase
Product (GenBank)PCZA361.5
GeneevaB
ORF25
Gene (GenBank)
EC number2.6.1.-
Keyword
  • L-4-epivancosamine
Note
Note (GenBank)
  • similar to sugar biosynthesis gene
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>dTDP-hexose C-3 aminotransferase [PCZA361.5]
MTTRVWDYLTEYQAERADLLDAVETVFNSGQLVLGASVRGFEAEFAAYHGVEHCVSLDNG
TNAIKLGLQALGVGPGDEVITVSNTAAPTVVAIDGTGATPVFVDVREDDFLMDTSQVAAA
ITDRTKCLLPVHLYGQCVNMAPLKELATKHGLSILEDCAQAHGARQNGTIAGSTGDAAAF
SFYPTKVLGAYGDGGATITSDQSVEQRLRRLRYYGMEKTYYTVETPAHNSRLDEVQAEIL
RRKLKRLDTYTAGRRAIAQRYVDGLGDTELKLPQTVPGNEHVYYVYVVRHPRRDDIIERL
KAYDIHLNISYPWPVHTMTGFAKLGYAEGSLPVTERLAKEIFSLPMYPALSADLQDKVIH
AVREVLSTL
selected fasta
>dTDP-hexose C-3 aminotransferase [PCZA361.5]
ATGACCACGCGTGTATGGGATTACCTGACCGAATACCAGGCCGAGCGGGCTGACCTGCTG
GACGCGGTCGAGACGGTCTTCAACTCGGGACAGCTCGTGCTCGGCGCGAGCGTGCGCGGT
TTCGAGGCGGAATTCGCCGCCTACCACGGGGTTGAGCACTGTGTCAGCCTCGACAACGGC
ACGAACGCGATCAAGCTCGGCCTGCAGGCGCTGGGCGTCGGGCCGGGCGACGAGGTGATC
ACGGTGTCGAACACCGCCGCCCCGACCGTGGTCGCCATCGACGGCACAGGCGCCACCCCG
GTCTTCGTCGACGTCCGCGAGGACGACTTCCTGATGGACACCAGCCAGGTCGCGGCCGCG
ATCACCGACCGCACCAAGTGCCTGCTGCCCGTGCACTTGTACGGCCAGTGCGTGAACATG
GCTCCACTGAAGGAACTCGCCACCAAGCACGGACTGTCCATTTTGGAGGACTGTGCCCAG
GCGCACGGGGCCCGGCAGAACGGCACGATCGCGGGCTCGACCGGTGACGCGGCCGCGTTC
TCCTTCTACCCGACCAAGGTGCTCGGCGCGTACGGCGACGGCGGCGCGACCATCACGTCT
GACCAGTCCGTGGAGCAGCGGCTGCGGCGGTTGCGGTACTACGGCATGGAGAAGACGTAC
TACACGGTGGAAACGCCTGCCCACAACAGCCGTCTGGACGAGGTCCAGGCGGAAATCCTG
CGGCGCAAGCTCAAGCGGCTCGACACGTACACGGCCGGCCGCCGGGCCATCGCCCAGCGC
TACGTCGACGGCCTCGGCGACACCGAGCTGAAGCTTCCGCAGACCGTGCCCGGCAACGAG
CACGTGTACTACGTGTACGTGGTGCGGCACCCTCGGCGTGACGACATCATCGAGCGCCTC
AAGGCGTACGACATCCACTTGAACATCAGCTACCCGTGGCCCGTGCACACCATGACCGGG
TTCGCCAAGCTCGGCTACGCGGAGGGCTCGCTGCCGGTGACCGAGCGGCTCGCCAAGGAG
ATCTTCTCGCTGCCGATGTACCCCGCGCTGTCGGCTGACCTGCAGGACAAGGTCATCCAC
GCGGTCCGCGAAGTGCTGTCGACCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [15-363]  5.09999999999993e-116 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-368]  1.39999277195148e-90 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [16-246]  2.59999999999995e-75 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [247-367]  3.60000000000002e-38 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [12-369]  2.2999842048857e-103 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit