close all open/close all

CDS information : Chlor_00270


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction54,868 / 55,485 / + [in whole cluster]
20,624 / 21,241 / + [in contig]
Location54868..55485 [in whole cluster]
20624..21241 [in contig]
TypeCDS
Length618 bp (205 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-3-amino-4-keto-2,3,6-trideoxy-3-C-methyl-D-glucose 5-epimerase
Product (GenBank)PCZA361.16
GeneevaD
ORF26
Gene (GenBank)
EC number5.1.3.-
Keyword
  • L-4-epivancosamine
Note
Note (GenBank)
  • similar to epimerase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)
[12077451] Purification, crystallization and preliminary structural studies of dTDP-4-keto-6-deoxy-glucose-5-epimerase (EvaD) from Amycolatopsis orientalis, the fourth enzyme in the dTDP-L-epivancosamine biosynthetic pathway. (Acta Crystallogr D Biol Crystallogr. , 2002)
[15159413] The position of a key tyrosine in dTDP-4-Keto-6-deoxy-D-glucose-5-epimerase (EvaD) alters the substrate profile for this RmlC-like enzyme. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>dTDP-3-amino-4-keto-2,3,6-trideoxy-3-C-methyl-D-glucose 5-epimerase [PCZA361.16]
MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVR
GIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGH
AFVALEDDTVMSYMLSRSYVTQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQ
RQGLLPDYTTSQEIERRLTAVPVST
selected fasta
>dTDP-3-amino-4-keto-2,3,6-trideoxy-3-C-methyl-D-glucose 5-epimerase [PCZA361.16]
GTGCAAGCACGCAAACTCGCCGTCGACGGCGCGATCGAGTTCACCCCTCGCGTCTTCGCC
GACGACCGGGGCCTGTTGATCCTGCCGTACCAGGAAGAGGCCTTCGTCGAGGCGCACGGC
GGCCCGCTTTTCCGTGTGGCACAGACGATCCACAGCATGTCCAAGCGCGGCGTGGTGCGG
GGCATCCACTACACCGTGACGCCACCGGGTACCGCCAAATACGTCTACTGCGCCCGCGGC
AAGGCCATGGACATCGTGATCGACATCAGAGTCGGCTCGCCCACGTTCGGGCAGTGGGAC
TCGGTGCTGATGGACCAGCAGGATCCCCGGGCGGTGTACCTTCCGGTCGGCGTCGGCCAT
GCGTTCGTGGCCCTCGAGGACGACACCGTCATGTCGTACATGCTCTCCAGAAGCTATGTG
ACGCAGGACGAACTCGCCCTCTCGGCCCTGGATCCCGCACTGGGCCTGCCCATCGACATC
GGCGTCGAACCGATCGTGTCCGATCGGGACCGGGTGGCCATCACGCTCGCCGAGGCCCAG
CGGCAGGGCCTGCTGCCGGATTACACCACCAGTCAGGAGATCGAGCGGCGGCTGACCGCG
GTCCCCGTCTCGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [1-203]  PD001462
PD001462   dTDP_sugar_isom
 [4-178]  9.50000000000005e-54 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-202]  8.59998776239544e-63 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-190]  2.1e-55 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit