close all open/close all

CDS information : Chlor_00280


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction55,678 / 56,796 / + [in whole cluster]
21,434 / 22,552 / + [in contig]
Location55678..56796 [in whole cluster]
21434..22552 [in contig]
TypeCDS
Length1,119 bp (372 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)PCZA361.6
GenedpgA
ORF27
Gene (GenBank)
EC number
Keyword
  • type III PKS
  • Dpg
Note
Note (GenBank)
  • similar to chalcone synthase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)
[12240210] Biosynthesis of the vancomycin group of antibiotics: characterisation of a type III polyketide synthase in the pathway to (S)-3,5-dihydroxyphenylglycine. (Chem Commun (Camb). , 2001)
[14744141] Role of the active site cysteine of DpgA, a bacterial type III polyketide synthase. (Biochemistry. , 2004)
[22492619] Chain elongation and cyclization in type III PKS DpgA. (Chembiochem. , 2012)

close this sectionPKS/NRPS Module

C1
CHS98..370

close this sectionSequence

selected fasta
>polyketide synthase [PCZA361.6]
MGVDVSMTVSAAPAEDLSVLSGLTEITRFAGVGTAVSDTSYSQPELLEILDIEDPKIRSV
FLNSAIDRRFLTLPPESPGGGRVSEPQGDLLDKHKKLAVDMGCRALEACLKSAGATLSDL
RHLCCVTSTGFLTPGLSALIIRELGIDPHCSRSDIVGMGCNAGLNALNVVAGWSAAHPGE
LGVVLCSEACSAAYALDGTMRTAVVNSLFGDGSAALAVISGDRRVPGPRVLKFASYIITD
AVDAMRYDWDRDQDRFSFFLDPQIPYVVGAHAEIVINRLLSGTGLRRSDIGHWLVHSGGK
KVVDAVVVNLGLSRHDVRHTTGVLRDYGNLSSGSFLFSYERLAEEGVARPGDYGVLMTMG
PGSTIEMALIQW
selected fasta
>polyketide synthase [PCZA361.6]
ATGGGGGTGGATGTATCGATGACGGTCAGTGCCGCCCCCGCCGAGGACCTGTCCGTCCTT
AGTGGACTAACCGAGATCACCAGGTTCGCAGGTGTGGGCACCGCCGTGTCCGACACGTCC
TACTCACAGCCCGAGTTGCTGGAGATCCTCGACATCGAGGATCCCAAGATCCGGTCGGTC
TTCCTCAACAGCGCGATCGATCGGCGTTTTCTCACGCTTCCGCCGGAGAGCCCCGGCGGG
GGACGCGTGTCGGAACCACAGGGCGATCTGCTCGACAAACACAAGAAGCTCGCCGTCGAC
ATGGGCTGCCGGGCGCTCGAGGCCTGCCTGAAGTCGGCCGGAGCGACGCTCTCGGACCTG
CGACACCTGTGCTGCGTCACGTCGACCGGGTTCCTGACCCCCGGCCTGAGCGCATTGATC
ATTCGTGAGCTGGGCATCGACCCGCACTGCAGCCGTTCGGACATCGTTGGCATGGGCTGC
AACGCCGGCCTGAACGCGCTCAACGTGGTCGCGGGCTGGTCCGCGGCGCACCCGGGTGAG
CTCGGCGTCGTCCTGTGCAGCGAGGCGTGTTCCGCCGCTTACGCCCTGGACGGCACCATG
CGGACCGCAGTGGTCAACAGCTTGTTCGGCGACGGATCCGCCGCACTCGCCGTCATCTCC
GGTGATCGGCGTGTGCCCGGCCCGCGTGTGCTGAAGTTCGCGAGCTACATCATCACCGAC
GCGGTCGACGCGATGCGCTACGACTGGGACCGTGACCAGGACCGGTTCAGTTTCTTCCTC
GACCCGCAGATTCCTTACGTGGTCGGTGCGCACGCCGAGATCGTCATCAACAGGCTGCTG
TCCGGTACGGGGTTGCGCCGCAGCGACATCGGCCATTGGCTGGTGCACTCCGGCGGCAAG
AAGGTGGTCGACGCCGTCGTCGTCAACCTCGGCCTGAGCCGGCACGACGTCCGCCACACC
ACCGGTGTGCTGCGTGACTACGGAAACCTCTCCAGCGGCTCCTTCCTCTTCTCCTACGAG
CGACTCGCCGAAGAGGGCGTCGCCCGGCCTGGAGACTACGGCGTGCTCATGACCATGGGA
CCTGGCTCCACCATCGAAATGGCGCTGATCCAATGGTGA
[1] CHS98..370
[1] CHS292..1110

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001099 Chalcone/stilbene synthase, N-terminal (Domain)
 [98-218]  3.1e-14 PF00195
PF00195   Chal_sti_synt_N
IPR011141 Polyketide synthase, type III (Family)
 [1-372]  PIRSF000451
PIRSF000451   PKS_III
IPR012328 Chalcone/stilbene synthase, C-terminal (Domain)
 [257-370]  2.6e-14 PF02797
PF02797   Chal_sti_synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [30-224]  1.6e-39 G3DSA:3.40.47.10 [229-372]  5.79999999999997e-34 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [87-372]  1.40000506907309e-44 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit