close all open/close all

CDS information : Chlor_00300


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction57,593 / 58,891 / + [in whole cluster]
23,349 / 24,647 / + [in contig]
Location57593..58891 [in whole cluster]
23349..24647 [in contig]
TypeCDS
Length1,299 bp (432 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Product3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase
Product (GenBank)PCZA361.8
GenedpgC
ORF29
Gene (GenBank)
EC number
Keyword
  • Dpg
Note
Note (GenBank)
  • similar to enoyl hydratase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)
[15380180] DpgC is a metal- and cofactor-free 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase in the vancomycin biosynthetic pathway. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase [PCZA361.8]
MTTDSATLSPGLDHRALAEACRQVDDLLAELPAPPDRTSAEREAASSALDKIRAMRTDYV
EAHAEEIYAELTLGRTQYLRIDELVRAAAIAYPGLVPTDEQMAAERARPQAAKEGREIDQ
GIFLRGILRAPKAGPHLLDAMLRPTAKALRLLPEFVETGVVRMEAVRLERRDGVAYLTLC
RDDCLNAEDAQQVDDMETAVDLALLDPSVRVGMVRGGEMTHPRYQGRRVFCAGINLKKLS
SGDIPLVDFLLRRELGYIHKIVRGVLTEGSWHSRFVDKPWLAAVDSFAIGGGAQLLLVFD
HVLAASDSYFSLPAAKEGIIPGASNYRLSRFTGPRVARQVILGGRQIQADEPDARLILDE
VVPPEGMDTAIEGALARLDADAVRANRRMLNLAEEPPDEFRRYMAEFALQQALRIYGEDV
IGKVGRFAAGSA
selected fasta
>3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase [PCZA361.8]
GTGACAACGGATTCCGCGACGCTGTCGCCAGGGCTCGACCATCGAGCCCTGGCGGAGGCG
TGCAGACAAGTCGATGATCTGCTCGCCGAGCTGCCCGCGCCTCCTGACCGGACCTCCGCC
GAGCGTGAAGCCGCGTCCTCGGCGCTGGACAAGATCAGGGCGATGCGCACGGACTACGTC
GAGGCGCACGCCGAGGAGATCTACGCCGAACTCACTCTGGGCCGGACGCAGTACCTGCGC
ATCGACGAGCTCGTCCGCGCCGCCGCCATCGCCTATCCCGGCCTCGTGCCCACGGACGAG
CAGATGGCGGCCGAGCGCGCGCGGCCGCAGGCGGCCAAGGAAGGGCGCGAGATCGATCAG
GGCATATTCCTGCGTGGGATCCTGCGTGCCCCGAAGGCCGGTCCGCACTTGCTCGACGCC
ATGCTCCGGCCCACCGCCAAGGCTCTGCGGCTACTGCCCGAATTCGTCGAGACCGGCGTC
GTGCGAATGGAAGCGGTCCGGCTGGAACGCCGTGACGGTGTCGCGTACCTGACCCTGTGC
CGGGACGACTGCCTGAACGCCGAAGACGCGCAACAGGTCGACGACATGGAGACCGCGGTC
GATCTGGCGCTGCTCGATCCGTCCGTCCGGGTGGGGATGGTCCGGGGCGGAGAGATGACC
CATCCCCGGTATCAGGGGCGCCGCGTGTTCTGCGCCGGTATCAACCTCAAGAAGCTCAGC
TCCGGCGACATTCCCTTGGTCGACTTCCTGTTGCGGCGGGAGCTCGGCTACATCCACAAG
ATCGTTCGTGGTGTGCTCACGGAAGGTTCGTGGCACTCAAGGTTCGTCGACAAGCCATGG
CTGGCCGCCGTCGATTCGTTCGCCATCGGCGGCGGGGCTCAGCTGCTGCTGGTCTTCGAC
CACGTGCTGGCGGCCTCCGACAGCTACTTCAGCCTGCCCGCGGCGAAGGAAGGGATCATT
CCCGGCGCGTCGAACTACCGGCTCAGCCGGTTCACCGGGCCACGCGTGGCCAGGCAGGTG
ATCCTCGGCGGCCGTCAGATCCAGGCGGATGAGCCGGACGCACGGTTGATCCTCGACGAG
GTCGTCCCGCCGGAGGGGATGGACACGGCGATCGAGGGCGCACTGGCGCGCCTCGACGCG
GACGCGGTGCGGGCCAACCGGCGCATGCTGAACCTGGCTGAGGAACCACCCGACGAATTC
CGGCGGTATATGGCCGAATTCGCGTTGCAGCAGGCGTTGCGCATCTACGGCGAGGACGTG
ATCGGCAAGGTCGGCAGGTTCGCGGCGGGATCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [169-374]  2.90000000000001e-19 PF00378
PF00378   ECH
SignalP No significant hit
TMHMM No significant hit