close all open/close all

CDS information : Chlor_00310


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction58,888 / 59,691 / + [in whole cluster]
24,644 / 25,447 / + [in contig]
Location58888..59691 [in whole cluster]
24644..25447 [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productenoyl-CoA hydratase
Product (GenBank)PCZA361.9
GenedpgD
ORF30
Gene (GenBank)
EC number4.2.1.-
Keyword
  • Dpg
Note
Note (GenBank)
  • similar to enoyl hydratase
Reference
ACC
PmId
[9545426] Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. (Chem Biol. , 1998)
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>enoyl-CoA hydratase [PCZA361.9]
MSYTRVRYEKKDHVACVTMDRPDVLNAMDRRMHTELAEIWDDVEADDDIRAVVLTGAGNR
AFTVGQDLKERAQRNDAGEEESTFGSRGQAGHPRLTDRFTLSKPVVARVHGYALGGGFEL
VLACDIVIASEEAIFGLPEVQLGLIPGAGGVFRLPRQLPQKVAMGYLLTGRRMDAATALR
YGLVNEVVPLDELDQCVAGWTDSLVRAAPLSVRAIKQAALRSLDLPLEEAFTASYPWEER
RRRSEDAIEGVRAFTEKRDPVWTGHYM
selected fasta
>enoyl-CoA hydratase [PCZA361.9]
ATGAGCTACACCCGGGTGCGGTACGAGAAGAAGGATCACGTCGCCTGCGTGACGATGGAC
CGGCCCGACGTGCTGAACGCGATGGACCGGCGGATGCACACGGAGCTCGCCGAGATCTGG
GATGACGTCGAGGCCGATGACGACATCAGGGCGGTTGTACTGACCGGCGCGGGAAATCGC
GCGTTCACCGTCGGCCAGGACCTCAAGGAACGCGCGCAACGCAACGACGCGGGCGAGGAA
GAGTCGACGTTCGGCAGCCGGGGCCAGGCAGGCCATCCCCGGCTGACCGACCGTTTCACG
CTCTCCAAGCCCGTGGTTGCCCGGGTACACGGCTACGCGCTGGGCGGCGGCTTCGAGCTC
GTGCTCGCCTGCGACATCGTGATCGCCTCAGAGGAGGCGATATTCGGCCTGCCGGAGGTC
CAACTCGGCCTGATCCCCGGGGCGGGCGGCGTGTTCCGGCTGCCGCGGCAGCTGCCGCAG
AAGGTCGCGATGGGCTACCTGCTGACCGGGCGACGGATGGATGCGGCGACAGCGCTTCGA
TACGGACTGGTGAACGAGGTCGTGCCGCTGGATGAGCTGGATCAGTGCGTCGCCGGATGG
ACCGACAGCCTCGTGCGCGCCGCGCCGCTCTCGGTTCGCGCGATCAAACAGGCCGCGTTG
CGGTCGCTCGACCTCCCACTCGAGGAGGCATTCACCGCCTCGTATCCGTGGGAGGAGCGT
CGCAGGCGAAGCGAGGACGCGATCGAGGGCGTCCGGGCCTTCACTGAAAAACGGGATCCG
GTTTGGACAGGGCATTACATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [8-257]  8.60000000000005e-62 PF00378
PF00378   ECH
IPR018376 Enoyl-CoA hydratase/isomerase, conserved site (Conserved_site)
 [106-126]  PS00166
PS00166   ENOYL_COA_HYDRATASE
SignalP No significant hit
TMHMM No significant hit