close all open/close all

CDS information : Chlor_00330


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction62,434 / 60,908 / - [in whole cluster]
28,190 / 26,664 / - [in contig]
Locationcomplement(60908..62434) [in whole cluster]
complement(26664..28190) [in contig]
TypeCDS
Length1,527 bp (508 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)PCZA361.12
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chloroeremomycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[PCZA361.12]
MLRHVDESSATIWVETGGPCTVTIAGCSAETFQVSGHHYALVVVTGFSPGAPYEVHLDGA
QVWPQAGSTLPPSRIPVISSDDFTMVFGSCRMPESDDPELGTDALAAYARRMAGQDPADW
PASLVLLGDQIYADETSKATTQWITERRGTSEPVGVADFEEYVYLYREAWSTPEVRWLLS
TVPTSMILDDHEVIDDWNTSPAWRAHMAEKPWWAERETSALMSYWVYQHLGNLHPDELAT
DPTYGKVRAAEDAAEVLREFAQSAAGESDGRRATRWSYRRDFGRVRLLMIDTRAGRILSS
GKRSIVSDDEFEWIEANAEGSYDHLLIGSSLPWLMPHAISAMQTANEAESARPGLRGRIA
EKIRRAVDQEHWPAFKASFDRLTRLIQRSASGSAATVCVLSGDVHHLYAAEASFGTPVNA
KVYQLVCSPMHNRIPRIFHPLFRIGWSRALAVVLGKRSLRPPVKWRKIAGPYMTNALATL
RISGRKAVVELEKADANGLSPITAIPLG
selected fasta
>[PCZA361.12]
GTGCTGCGGCACGTGGACGAATCGTCGGCGACGATCTGGGTGGAGACCGGCGGGCCGTGC
ACCGTCACGATCGCTGGGTGCTCGGCGGAGACGTTCCAAGTCAGCGGCCATCACTACGCG
CTCGTCGTGGTCACGGGGTTCTCACCCGGTGCGCCGTACGAGGTTCATCTCGACGGCGCG
CAGGTCTGGCCGCAAGCCGGTTCGACGCTGCCGCCAAGCCGGATTCCCGTGATCTCGAGC
GACGACTTCACCATGGTCTTCGGGTCGTGCCGGATGCCCGAGAGCGACGACCCTGAACTC
GGCACCGACGCGTTGGCCGCCTACGCGCGGCGAATGGCCGGACAGGACCCCGCGGACTGG
CCGGCCTCGCTGGTGCTGCTCGGCGACCAGATCTACGCCGACGAGACGTCCAAGGCCACC
ACGCAGTGGATCACCGAGCGGCGCGGGACCAGTGAGCCGGTGGGCGTCGCCGACTTCGAG
GAGTACGTGTACCTCTACCGCGAGGCGTGGTCGACACCGGAGGTGCGCTGGCTGCTGTCG
ACCGTGCCGACGTCGATGATCCTCGACGACCACGAGGTCATCGACGACTGGAACACCTCG
CCGGCCTGGCGGGCGCACATGGCCGAGAAGCCGTGGTGGGCCGAGCGGGAGACCAGTGCC
CTCATGTCGTATTGGGTGTACCAGCACCTGGGCAACCTGCACCCGGACGAACTGGCCACC
GACCCGACGTACGGGAAGGTCCGTGCCGCCGAGGACGCCGCCGAGGTGCTGCGGGAGTTC
GCGCAGTCGGCGGCCGGGGAGTCCGATGGCCGCCGGGCGACTCGGTGGAGCTATCGGCGT
GACTTCGGGCGTGTCCGGCTGCTGATGATCGACACCAGGGCGGGCCGGATTCTGTCCAGC
GGGAAGCGTTCGATCGTCAGCGACGACGAGTTCGAATGGATCGAGGCCAACGCCGAGGGC
TCGTACGACCACCTGCTGATCGGCTCGTCGCTGCCCTGGCTGATGCCACACGCGATCAGC
GCCATGCAGACGGCCAACGAAGCCGAAAGCGCGCGGCCCGGACTACGCGGCCGGATCGCC
GAGAAGATCCGCCGAGCGGTCGATCAGGAGCACTGGCCTGCGTTCAAGGCATCGTTCGAC
CGCCTGACCCGGCTCATACAGCGGTCCGCCTCCGGCTCCGCGGCGACCGTGTGCGTGCTG
TCGGGCGACGTGCACCATCTCTACGCGGCCGAGGCGAGCTTCGGCACCCCGGTCAATGCC
AAGGTGTACCAACTGGTCTGCTCCCCCATGCACAACCGGATCCCCCGGATCTTCCACCCG
CTGTTCCGGATCGGCTGGTCCCGTGCTTTGGCTGTCGTGCTGGGAAAGCGGTCCCTGCGA
CCGCCCGTGAAGTGGCGCAAGATCGCGGGACCGTACATGACCAACGCACTGGCCACACTC
CGGATCAGCGGCCGCAAGGCAGTGGTGGAACTGGAAAAGGCCGACGCCAACGGCCTCAGT
CCGATCACCGCCATCCCGCTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR018946 Alkaline phosphatase D-related (Family)
 [38-412]  1e-18 PF09423
PF09423   PhoD
SignalP No significant hit
TMHMM No significant hit