close all open/close all

CDS information : Chlor_00340


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction62,662 / 66,672 / + [in whole cluster]
28,418 / 32,428 / + [in contig]
Location62662..66672 [in whole cluster]
28418..32428 [in contig]
TypeCDS
Length4,011 bp (1,336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)PCZA361.13
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chloroeremomycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[PCZA361.13]
MRMRRSAAVTALVAFGLSLAVPVTAAQTIGYPSFTGPAVAQPPVAYTTNDMMRAIYDRES
QGTDFWMDRLLARQGNDPAGTWLMTRGRAVFMKTHDPAVIGFGGQVAYWESIDNRGAYSI
SLSPGTFTENAAQRVQAPSYWKGLYTSGSLRVEALKFITHNNAAVTNLTVTNTGSSQQTL
QLRASSPYTQTVEGNELTGIVDAKNKLTTVFPRLAGDGFTVSGTDLTRSITVPAGQSVQT
KVVMGFVTEEIPASLTEYQSYRDATPAAAHATHVRAYNRWWADNVPYFDVPDPAIKKHIY
YRWWLMRFNYLDADIPGNDFQFPTSVEGALGYNNAIVLTVPMFVDDLKYLRNPMYSFGPW
VSAGEVSRNRRYTDNPGDPENWSNSYTQYISEAAWRSYQIHGGQPAIAGNLARYAEQDVK
GQLDFYDQDRNNLIEYDWGALTGNDADAVSFHWRDGRLDRTESAYVYSNALAAAQAYETV
GNTAKANEMRAIAARVQQAVVDVLWNQQAQVLQHRHVATNSLVPWKEINNFYPYSVGLMP
NTAQYREALRLLADEKEYPIFPFYTANQRDKAAAAAAGKPGTNNFSQINSTVQFRLLSSA
LRNYPTSYVTTEMYKKLLYWNAWAQYIGGDTRWPDSNEFWADWNVATKTIDYRSWIHHTT
LGSSNWTVVEDAMGLRPRNDDKVELSPINIGWSHFTVNNLRYRNNNLTIVWDDPADGITR
YPGVPEGYSVYVNGNRAVTIDRLTHAIWDPRTGAVTFPGQAGTVLHSVSVSGMQTPGQVV
HTDPRMVDVFAKAGVNLQPNSPNLAAGATASGSYTATGTTTAAAVDGFTINEPFWGSKGS
PNAQDYYELDLGAAKKFDEARVHFGNDRAGYAEPAMYQVQYLNGSTWVTLPGHKTPAVPR
SNYNRVQFPAITAQRVRVVMTHQPGLKTGLTEVKLFATGSPPAATNTAPYVLARRDPAFN
QPGQARLLGKVKDDTLPSGTLTSTWSKVNGPGNVVFGTPNSATTLASFSATGTYTLRLTA
SDGAVSSSSQVTLTVTQGSAFNLAPSATPSASYTSSWESVAALNDGVDPGSSNDSPRWGT
WPETGQQWAELMWAQPQRLNAAALYFFDDGGGVRVPSAWKLQYWNGSSYVDIPSSYPVTV
NQFNNASFPGVTTTRLRAVLTSGAGSVGLVEFKALAETPASLRPVHQPTLVGQVPTLPAK
ATKIYASGARLDSQVTWQPIDPAQVGTGGTSFAVQGIVDGTGVPASATVWVRSTNQVSIT
FIEPENIVTTVGVAPALPPTVTATFNDGSRDNVTTSVTWAAVDPSRYAQPGTFTVTGQVP
GTSLIAQANVEVKANG
selected fasta
>[PCZA361.13]
ATGCGTATGCGCAGATCAGCCGCCGTGACCGCGTTGGTCGCATTCGGACTGTCCTTGGCA
GTGCCCGTGACCGCGGCACAGACCATCGGTTACCCGAGCTTCACGGGGCCTGCCGTTGCT
CAGCCGCCGGTCGCGTACACCACGAACGACATGATGCGGGCCATCTACGACCGGGAGAGC
CAGGGCACCGACTTCTGGATGGACCGGTTGCTTGCCCGGCAGGGCAACGATCCCGCCGGT
ACCTGGTTGATGACCCGGGGTCGTGCCGTGTTCATGAAGACGCACGATCCTGCCGTGATC
GGATTCGGCGGTCAGGTCGCCTACTGGGAAAGCATCGACAACCGCGGCGCGTACTCGATC
AGCCTGAGCCCTGGCACGTTCACCGAGAACGCCGCCCAGCGCGTGCAGGCACCGAGCTAC
TGGAAAGGCTTGTACACCAGTGGTTCCCTCCGGGTTGAGGCCCTGAAGTTCATCACGCAC
AACAATGCCGCGGTCACCAACCTCACTGTCACCAACACCGGGAGCAGTCAGCAGACCCTG
CAGTTGCGGGCCAGCTCGCCGTACACCCAGACCGTGGAAGGCAACGAGCTCACCGGGATC
GTGGACGCGAAGAACAAGCTCACCACGGTGTTCCCCAGGCTGGCCGGAGACGGGTTCACG
GTCAGCGGCACCGATCTGACCCGCTCGATCACCGTCCCGGCAGGCCAAAGTGTACAGACC
AAGGTCGTCATGGGGTTCGTGACCGAGGAGATCCCGGCGTCGCTGACCGAGTACCAGTCC
TACCGGGACGCGACTCCCGCCGCGGCCCACGCCACCCACGTGCGTGCCTACAACCGTTGG
TGGGCGGACAATGTGCCGTACTTCGACGTCCCGGACCCGGCGATCAAGAAGCACATCTAC
TACCGCTGGTGGCTGATGCGCTTCAACTACCTCGACGCGGACATCCCCGGCAACGACTTC
CAGTTCCCCACATCGGTCGAAGGCGCGCTGGGATACAACAACGCGATCGTGCTGACCGTG
CCGATGTTCGTCGACGACCTGAAGTACTTACGCAATCCCATGTACTCGTTCGGGCCGTGG
GTCTCTGCCGGTGAGGTCTCCCGTAACCGCCGGTACACCGACAATCCCGGCGATCCGGAG
AACTGGAGCAACAGCTACACGCAGTACATCTCCGAGGCAGCATGGCGTAGCTACCAGATC
CACGGCGGGCAGCCGGCGATCGCGGGCAATCTCGCCCGCTACGCCGAGCAGGATGTCAAG
GGGCAGCTGGACTTCTACGACCAGGACCGCAACAACCTGATCGAGTACGACTGGGGTGCG
CTGACCGGCAACGATGCCGACGCGGTTTCGTTCCACTGGCGTGACGGACGCCTGGACCGC
ACCGAGTCCGCGTACGTCTACAGCAACGCTTTGGCCGCGGCGCAGGCTTACGAGACGGTC
GGCAACACCGCGAAGGCCAACGAGATGCGTGCCATCGCTGCTCGTGTTCAGCAGGCTGTC
GTGGACGTCCTGTGGAACCAGCAGGCACAGGTGTTGCAGCACAGGCATGTGGCGACCAAC
TCGTTGGTGCCGTGGAAGGAGATCAACAACTTCTACCCGTACTCGGTCGGCCTGATGCCG
AACACCGCGCAGTACCGGGAAGCGCTGCGGTTGCTGGCCGACGAGAAGGAATACCCGATC
TTCCCGTTCTACACGGCCAACCAGCGGGACAAAGCCGCCGCGGCGGCCGCGGGCAAGCCC
GGTACCAACAACTTCTCGCAGATCAACTCGACCGTGCAGTTCCGGCTGCTGTCCTCGGCC
CTGCGCAATTACCCGACCTCGTACGTCACCACGGAGATGTACAAGAAACTGCTGTACTGG
AACGCGTGGGCGCAGTACATCGGCGGCGACACCCGGTGGCCTGACTCCAACGAGTTCTGG
GCCGACTGGAACGTTGCCACCAAGACGATCGACTACCGCTCGTGGATCCACCACACGACA
CTGGGCAGCAGCAACTGGACGGTCGTCGAGGACGCGATGGGCCTGCGGCCACGCAACGAC
GACAAGGTCGAGCTGTCCCCGATCAACATCGGCTGGTCCCATTTCACGGTCAACAACCTG
CGGTATCGCAACAACAACCTGACCATCGTCTGGGACGACCCTGCTGACGGGATCACCCGC
TACCCGGGTGTTCCCGAGGGATATTCGGTCTACGTCAACGGAAACCGGGCCGTCACGATC
GACCGTCTGACCCATGCGATCTGGGATCCACGGACCGGCGCGGTGACGTTCCCCGGGCAA
GCGGGAACCGTGCTGCACAGCGTGTCCGTGAGCGGGATGCAGACGCCCGGCCAGGTCGTG
CACACCGATCCCCGGATGGTCGACGTGTTCGCCAAGGCCGGTGTGAACCTGCAGCCGAAC
AGCCCGAACCTGGCAGCCGGCGCCACCGCGTCGGGGTCGTACACGGCCACCGGAACGACA
ACAGCGGCCGCGGTGGACGGCTTCACGATCAACGAACCGTTCTGGGGCAGCAAAGGATCG
CCGAACGCGCAGGACTACTACGAACTCGACCTGGGCGCTGCCAAGAAGTTCGACGAAGCC
CGCGTGCATTTCGGTAATGACAGGGCCGGGTACGCCGAACCCGCCATGTACCAGGTCCAA
TACCTCAACGGAAGTACATGGGTGACGCTGCCAGGCCACAAGACACCGGCAGTGCCCAGA
TCCAACTACAACCGGGTGCAGTTCCCCGCGATCACCGCACAGCGGGTCCGGGTGGTGATG
ACGCACCAGCCCGGGCTGAAAACCGGGCTGACCGAGGTGAAGCTCTTCGCCACCGGCAGT
CCACCGGCGGCCACCAACACAGCGCCCTATGTCCTTGCGAGGCGCGATCCGGCCTTCAAC
CAGCCAGGACAGGCGAGATTGCTCGGCAAGGTCAAGGATGACACCCTTCCGTCCGGCACG
TTGACCTCGACGTGGTCCAAAGTGAACGGTCCTGGCAACGTCGTCTTCGGCACGCCCAAC
TCGGCCACCACCTTGGCGTCCTTCAGCGCCACTGGCACGTACACCCTTCGATTGACGGCC
AGTGATGGTGCCGTGTCGTCCTCATCCCAGGTGACTTTGACTGTCACACAAGGCTCCGCG
TTCAACCTCGCTCCGTCGGCGACACCGTCCGCCTCGTACACGTCCTCGTGGGAAAGCGTG
GCGGCGTTGAACGACGGGGTCGATCCCGGAAGCTCGAACGACAGCCCAAGGTGGGGCACG
TGGCCGGAGACCGGGCAGCAGTGGGCCGAACTCATGTGGGCACAGCCGCAACGACTGAAT
GCCGCCGCGCTCTACTTCTTCGATGACGGCGGGGGAGTGCGGGTGCCGAGCGCCTGGAAA
CTCCAGTACTGGAACGGTTCCTCGTACGTCGACATCCCGAGTTCCTACCCCGTGACCGTC
AACCAGTTCAACAACGCCTCTTTCCCAGGTGTGACAACGACAAGGCTACGGGCAGTGCTC
ACCTCCGGTGCCGGATCCGTTGGCCTGGTCGAGTTCAAAGCACTGGCGGAGACTCCGGCT
TCGCTCAGGCCCGTGCACCAGCCGACGCTAGTGGGGCAGGTGCCGACGCTGCCCGCCAAG
GCGACCAAGATCTACGCCAGCGGCGCGCGTCTCGATTCCCAGGTCACGTGGCAGCCCATC
GATCCCGCCCAAGTCGGCACGGGAGGCACGAGTTTCGCCGTTCAGGGCATTGTGGACGGC
ACCGGCGTGCCCGCGTCGGCAACGGTTTGGGTGCGGTCGACCAACCAAGTCAGCATCACG
TTCATCGAACCCGAGAACATCGTGACCACCGTCGGTGTGGCACCTGCGCTGCCGCCGACC
GTCACAGCGACCTTCAACGACGGCTCACGTGACAACGTCACCACGTCGGTGACGTGGGCT
GCTGTCGATCCGTCGCGTTACGCACAACCAGGGACCTTCACCGTGACTGGCCAAGTTCCC
GGCACATCACTGATCGCACAGGCGAACGTGGAGGTGAAAGCCAATGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000421 Coagulation factor 5/8 C-terminal type domain (Domain)
 [790-938]  PS50022
PS50022   FA58C_3
IPR008928 Six-hairpin glycosidase-like (Domain)
 [250-717]  3.80000697093586e-20 SSF48208
SSF48208   Glyco_trans_6hp
IPR008979 Galactose-binding domain-like (Domain)
 [794-943]  4.39999967439747e-09 SSF49785
SSF49785   Gal_bind_like
IPR011081 Bacterial Ig-related (Domain)
 [1185-1241]  1.3e-06 PF07532 [1262-1322]  2.9e-16 PF07532
PF07532   Big_4
SignalP
 [1-26]  0.874 Signal
Eukaryota   
 [1-25]  0.882 Signal
Bacteria, Gram-negative   
 [1-40]  0.738 Signal
Bacteria, Gram-positive   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1