close all open/close all

CDS information : Chlor_00350


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction66,816 / 67,127 / + [in whole cluster]
32,572 / 32,883 / + [in contig]
Location66816..67127 [in whole cluster]
32572..32883 [in contig]
TypeCDS
Length312 bp (103 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)PCZA361.31
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chloroeremomycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[PCZA361.31]
MLSRHRQETRFPESPSTRLTFTGSGQTTRKLRIPSWTSNARIRINGTTNPSTMPTLNPAS
IRTTSTPLQFTATASTGPVNLLPFYAMHGQRYTVYWRIGSAAP
selected fasta
>[PCZA361.31]
GTGCTGTCACGGCACCGGCAGGAGACGCGGTTCCCGGAGTCGCCGTCGACAAGGCTGACC
TTCACCGGATCCGGCCAGACCACACGGAAGCTGAGAATCCCGTCGTGGACGTCGAATGCA
CGGATCCGCATCAACGGCACGACGAATCCGTCCACAATGCCCACCCTGAATCCGGCCTCG
ATCCGGACCACGAGCACACCGTTGCAGTTCACCGCGACAGCGAGTACCGGGCCGGTGAAC
CTGCTGCCGTTCTACGCCATGCACGGCCAGCGGTACACGGTGTACTGGCGGATCGGCTCC
GCTGCCCCATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012878 Protein of unknown function DUF1680 (Family)
 [6-49]  1.3e-07 PF07944
PF07944   DUF1680
SignalP No significant hit
TMHMM No significant hit