close all open/close all

CDS information : Chlor_00360


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction67,145 / 67,990 / + [in whole cluster]
32,901 / 33,746 / + [in contig]
Location67145..67990 [in whole cluster]
32901..33746 [in contig]
TypeCDS
Length846 bp (281 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)PCZA361.15
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chloroeremomycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[PCZA361.15]
MKRRRGTALLAAVAATVSMFSMVSAPAANAADQWNPPANLVRPIDEVWRHVETTYPNLYG
FRNYGWDQIMANRGYINYCVRWDSNQPVTAALRDRIHAALARQFKKWMDVQLENGQGYNN
WPYREVPLKVVGWAVRNRSTLQWSDSSVDIYVGNINENAPQCAPECGRFFNQSGNYPRCP
GGVARHYDMSLWLTAGLGGGFGGDWGQRIGSEYYVNSLNNDNIHILLHEIGHSFGLDDFY
DWTPTGVCCFLMKAGSAAQITEFDKWMFRDFWRHLKSRYGY
selected fasta
>[PCZA361.15]
ATGAAACGACGAAGGGGCACCGCCCTGCTGGCCGCGGTCGCGGCCACGGTGTCCATGTTC
TCGATGGTGTCGGCGCCCGCCGCGAACGCGGCGGACCAGTGGAACCCACCGGCGAACCTC
GTCCGGCCGATCGACGAGGTCTGGCGGCACGTCGAGACCACGTATCCGAACCTGTACGGA
TTCCGGAACTACGGCTGGGACCAGATCATGGCCAACCGTGGATACATCAACTACTGCGTG
CGGTGGGACTCCAACCAGCCGGTGACCGCGGCCCTGCGCGACCGGATCCACGCGGCACTG
GCCCGGCAGTTCAAGAAGTGGATGGACGTCCAGCTGGAGAACGGCCAAGGCTACAACAAC
TGGCCGTACCGCGAGGTTCCGCTGAAAGTCGTCGGCTGGGCCGTACGCAACCGCAGCACT
CTGCAGTGGTCGGACAGTTCCGTCGACATCTACGTGGGCAACATCAACGAGAACGCACCG
CAGTGCGCTCCCGAATGTGGCCGGTTCTTCAACCAGAGCGGCAATTACCCGCGCTGCCCT
GGCGGAGTCGCGCGGCACTATGACATGTCGCTGTGGCTGACCGCCGGTTTGGGCGGTGGT
TTCGGTGGCGATTGGGGTCAGCGGATCGGCAGCGAGTACTACGTGAACTCGCTCAACAAC
GACAACATTCACATCCTGTTGCACGAGATCGGCCATTCGTTCGGTCTTGACGACTTCTAC
GACTGGACGCCGACGGGTGTCTGCTGCTTCCTGATGAAGGCGGGCAGCGCCGCGCAGATC
ACCGAGTTCGACAAGTGGATGTTCCGCGACTTCTGGCGGCATCTGAAGAGCCGGTACGGA
TATTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR024079 Metallopeptidase, catalytic domain (Domain)
 [199-257]  2.9e-06 G3DSA:3.40.390.10
G3DSA:3.40.390.10   G3DSA:3.40.390.10
SignalP
 [1-30]  0.87 Signal
Bacteria, Gram-negative   
 [1-30]  0.637 Signal
Eukaryota   
 [1-30]  0.808 Signal
Bacteria, Gram-positive   
TMHMM No significant hit