close all open/close all

CDS information : Chlor_00370


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction68,577 / 68,029 / - [in whole cluster]
34,333 / 33,785 / - [in contig]
Locationcomplement(68029..68577) [in whole cluster]
complement(33785..34333) [in contig]
TypeCDS
Length549 bp (182 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)PCZA361.29
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chloroeremomycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[PCZA361.29]
MNLAPLDPDRVGWTGGIESITLDGTRYFFGFDYSSDLVLSPLIEDQATMAAYAAKYMAQR
DGTHDEAYWAELVTDAVDGSDLTEPDDRDFSTDDLRSGRTTYHLRYLLGAASSWNTDMFE
DDEVVAALKRLELDPDEEWESVDRCMELTGPDAELVVSRYFGSLAANLQGNWRTVFAPLI
DR
selected fasta
>[PCZA361.29]
GTGAACTTGGCACCATTGGACCCCGACCGGGTCGGCTGGACCGGCGGGATCGAATCGATC
ACGCTGGACGGCACCCGGTACTTCTTCGGGTTCGACTACAGCAGCGACCTGGTCCTCTCC
CCTCTGATCGAGGACCAGGCAACGATGGCGGCGTACGCGGCGAAGTACATGGCGCAGCGC
GACGGCACCCATGACGAGGCCTATTGGGCGGAACTCGTCACCGACGCGGTGGACGGTTCC
GATCTGACCGAACCGGACGACCGTGACTTCTCCACCGACGACCTGCGGTCCGGGCGGACG
ACCTATCACCTGCGTTACCTGCTGGGCGCGGCGAGCTCGTGGAATACCGACATGTTCGAG
GACGACGAGGTCGTCGCCGCCTTGAAGCGCCTTGAACTCGATCCGGACGAGGAGTGGGAG
TCCGTCGACCGCTGCATGGAACTGACCGGTCCGGACGCGGAACTGGTGGTGTCCCGGTAC
TTCGGGTCGCTCGCGGCGAACCTGCAGGGAAACTGGCGGACCGTGTTCGCGCCCTTGATC
GACCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit