close all open/close all

CDS information : Chlor_00380


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction69,987 / 68,599 / - [in whole cluster]
35,743 / 34,355 / - [in contig]
Locationcomplement(68599..69987) [in whole cluster]
complement(34355..35743) [in contig]
TypeCDS
Length1,389 bp (462 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)PCZA361.14
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chloroeremomycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[PCZA361.14]
MRRLLALIVAGLALSVLAMPAAQAQPRAAGSITFRHSLQPIDGFGFSQAFQRAARIRGLS
PGNQRAVLDLLLNRNTGAGLSILRLGIGSSADNVYDHMRSIQPVDPGGPTAPPKYVWDGD
DGGQVWLAKHAKAYGVTRFYADAWSAPGYMKDNGNDANGGTLCGLQGTTCASGDWRQAYA
DYLVQYARFYANEGIGITDLGFTNEPDLTTSYASMRFTLVQAVEFAKILGPRARPMKVAC
CDAAGWSQQIEYTAAIEADPLARAQVATHTGHPYRNPVTGPLPTNKRTWMSEWSPNGTTW
NEAWDDNSGYDGFAVAQNIHETLTTGQANGYVFWFGASLGATRGLIQLGDGTDSYRVSKR
LWALASYSRFIRPDAVRVPARAGDAALKVSAYRNVDGSRVVTILNTATTTVNTDFTLDVP
GRPTAYVTDTTRSMSATDTVQVRGRTLSANLAPRSLTTVVLR
selected fasta
>[PCZA361.14]
ATGAGGCGCCTCCTCGCACTCATCGTCGCCGGGCTCGCCCTGTCAGTCCTGGCGATGCCC
GCGGCACAGGCGCAGCCGCGTGCCGCGGGCAGCATCACCTTCCGCCACAGCCTCCAGCCC
ATCGACGGATTCGGCTTCTCCCAGGCATTTCAGCGCGCGGCCCGGATACGTGGCCTGTCG
CCGGGCAACCAACGTGCAGTGCTCGACCTCCTGCTCAACCGGAACACGGGCGCTGGACTG
AGCATTCTGCGGCTGGGCATCGGTTCGTCCGCCGACAACGTCTACGACCACATGCGTTCC
ATCCAGCCGGTGGACCCCGGTGGCCCAACCGCGCCGCCGAAGTACGTGTGGGACGGCGAT
GACGGTGGGCAGGTGTGGTTGGCCAAGCATGCCAAGGCATACGGCGTGACTCGTTTCTAC
GCCGATGCTTGGAGCGCACCCGGCTACATGAAGGACAACGGCAACGACGCGAACGGCGGA
ACACTCTGTGGCCTGCAGGGCACGACCTGCGCCAGTGGCGACTGGCGGCAGGCCTATGCG
GACTATCTGGTGCAGTACGCCCGGTTCTACGCCAACGAAGGCATCGGCATCACCGACCTC
GGGTTCACCAACGAACCTGACCTGACAACCTCCTACGCCTCCATGCGGTTCACCCTCGTG
CAGGCCGTCGAGTTCGCGAAGATACTCGGTCCACGCGCCCGGCCCATGAAAGTCGCCTGC
TGTGACGCGGCGGGCTGGAGCCAGCAAATCGAGTACACCGCGGCGATCGAGGCGGATCCC
TTGGCGCGGGCGCAGGTTGCGACACACACGGGCCACCCGTACCGCAATCCGGTCACCGGA
CCGTTGCCGACCAACAAGCGGACCTGGATGTCCGAGTGGTCACCGAACGGCACCACCTGG
AACGAGGCTTGGGACGACAACAGCGGGTACGACGGTTTCGCGGTGGCGCAGAACATCCAC
GAGACGCTGACCACTGGGCAGGCGAACGGCTACGTGTTCTGGTTCGGTGCGTCTCTCGGC
GCCACCCGTGGCTTGATCCAGCTCGGTGACGGTACTGACAGCTACCGGGTTTCCAAACGG
TTGTGGGCCTTGGCTTCCTACAGCCGGTTCATCCGGCCGGACGCCGTGCGTGTGCCGGCG
CGGGCAGGCGACGCCGCGCTGAAGGTTTCGGCGTACCGCAACGTGGACGGCAGCCGGGTG
GTCACGATCCTCAACACCGCGACCACGACCGTCAACACCGATTTCACCCTCGACGTGCCG
GGCCGTCCGACCGCTTACGTCACAGACACCACGCGTTCCATGTCGGCGACCGATACTGTT
CAGGTACGAGGCCGGACACTCTCCGCGAACCTCGCTCCCCGATCGCTGACCACAGTGGTG
CTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001139 Glycoside hydrolase, family 30 (Family)
 [35-219]  1.1e-07 PF02055 [361-416]  0.00013 PF02055
PF02055   Glyco_hydro_30
IPR013780 Glycosyl hydrolase, family 13, all-beta (Domain)
 [367-461]  3.09999999999998e-23 G3DSA:2.60.40.1180
G3DSA:2.60.40.1180   Glyco_hydro_13_b
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [39-366]  2.59999999999995e-92 G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [41-375]  2.1000026783403e-49 SSF51445
SSF51445   Glyco_hydro_cat
SignalP
 [1-24]  0.823 Signal
Eukaryota   
 [1-24]  0.774 Signal
Bacteria, Gram-positive   
 [1-24]  0.879 Signal
Bacteria, Gram-negative   
TMHMM
 [5-24]  Transmembrane (i-o)
Transmembrane 1