close all open/close all

CDS information : Chlor_00390


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction71,471 / 69,984 / - [in whole cluster]
37,227 / 35,740 / - [in contig]
Locationcomplement(69984..71471) [in whole cluster]
complement(35740..37227) [in contig]
TypeCDS
Length1,488 bp (495 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)PCZA361.11
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chloroeremomycin biosynthesis.
Note (GenBank)
  • similar to gluconase

close this sectionSequence

selected fasta
>[PCZA361.11]
MWRHHLGMAAAAGVLASLVSTPAAAQPRPAAVPGLAEISVTTTQVAFGLRRPTAIVAPDD
GSGRLFITEKAGTVRAYHPTTGLAADPILSIQDRVSQTGNERGLLGIAASPGFAHDQTVY
LAYTRVPDSAVTLARYRLTDGQIEELLNQEHATYSNHNGGHIAFGKDGYLYWGIGDGGDA
GDPFRSGQRLDTLLGKILRLDVSRACDPLPYCIPAGNPFAGVAGARAEIWAYGLRNPWKF
SLDPADGSLWIGDVGQGAFEEIDHLTAGGANLGWSCREGPQVFDPARCTPGATYTDPVFS
YQTSVEGCSVIGGVVYRGSRYADLAAGTYVASDYCSNPAWALRKNADGTYSQAKIGEFPI
QPTSFGTSADGEIYLVNDLPGQLHQVGFARKVDCSVAYRVDSQWGNGFTASVTVTNNGTT
AIDGWSLRWTFENSQQVSNGWNAAVRQSDQAVSAAAANWNTKIDPGKSVTFGFLASHSGL
NPPPKSFALNESSCR
selected fasta
>[PCZA361.11]
ATGTGGCGACACCATCTGGGTATGGCCGCCGCGGCAGGAGTGCTGGCCAGCCTGGTCAGC
ACTCCAGCGGCAGCCCAGCCGCGGCCAGCGGCGGTTCCCGGCCTGGCCGAAATCTCGGTC
ACCACTACGCAAGTGGCCTTCGGGCTGCGCAGACCCACGGCGATCGTGGCTCCGGACGAC
GGCAGTGGCCGCCTGTTCATCACTGAGAAGGCAGGCACTGTCCGCGCCTACCACCCGACG
ACCGGCCTGGCGGCCGACCCGATCCTGAGCATCCAGGACCGCGTCAGCCAGACCGGCAAC
GAACGCGGCCTGCTCGGCATCGCCGCGTCACCAGGCTTTGCCCACGACCAGACGGTGTAC
CTGGCGTACACCCGGGTTCCGGACAGCGCGGTCACCCTGGCGCGATATCGGCTGACCGAT
GGCCAGATCGAGGAGTTGTTGAACCAGGAGCACGCTACGTACTCCAACCACAACGGTGGT
CACATCGCGTTCGGCAAGGACGGCTACCTCTACTGGGGAATCGGCGACGGCGGTGACGCG
GGCGATCCGTTCCGCAGTGGCCAGCGCCTGGACACGTTGCTGGGCAAGATCCTTCGGCTG
GACGTCAGCCGGGCCTGTGATCCGCTGCCGTACTGCATTCCGGCGGGCAATCCGTTCGCC
GGCGTTGCGGGCGCGCGAGCGGAGATCTGGGCGTACGGGCTGCGTAACCCGTGGAAGTTC
TCTCTCGATCCGGCTGACGGGTCACTGTGGATCGGTGACGTCGGACAAGGCGCGTTCGAG
GAGATCGACCACTTGACCGCGGGTGGCGCGAACCTGGGATGGTCCTGCCGGGAAGGTCCG
CAGGTCTTCGACCCTGCCCGATGCACGCCGGGAGCCACGTACACCGATCCGGTGTTCAGC
TATCAGACCTCGGTCGAAGGGTGCTCGGTCATCGGCGGGGTCGTCTACCGCGGCTCCCGG
TACGCGGACCTGGCCGCTGGCACGTACGTGGCCTCCGACTACTGCAGCAACCCCGCCTGG
GCACTGCGCAAGAACGCCGACGGCACGTACTCCCAGGCGAAGATCGGTGAGTTCCCCATC
CAGCCGACCAGTTTCGGCACGTCCGCCGATGGCGAGATCTACCTGGTCAACGACCTGCCA
GGACAACTGCACCAAGTCGGCTTCGCGCGCAAGGTGGACTGTTCGGTGGCCTACCGGGTG
GATTCCCAGTGGGGTAACGGGTTCACCGCGTCGGTGACCGTCACCAACAACGGCACCACG
GCCATCGACGGCTGGAGCTTGCGATGGACTTTCGAGAACAGCCAGCAGGTCTCGAACGGC
TGGAACGCCGCGGTGCGGCAGAGCGACCAGGCTGTCTCGGCGGCCGCCGCGAACTGGAAC
ACGAAGATCGATCCAGGCAAGTCGGTGACGTTCGGCTTCCTCGCGTCCCACAGTGGCCTG
AATCCCCCGCCGAAGTCGTTCGCCCTGAACGAATCGAGTTGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001919 Cellulose-binding domain, family II, bacterial-type (Domain)
 [394-494]  8.30001403791594e-51 SM00637
SM00637   CBD_II
 [394-494]  1.3e-30 PF00553
PF00553   CBM_2
 [387-495]  PS51173
PS51173   CBM2
IPR008965 Carbohydrate-binding domain (Domain)
 [388-494]  1.20000117458134e-32 SSF49384
SSF49384   Cellul_bind
IPR011041 Soluble quinoprotein glucose/sorbosone dehydrogenase (Domain)
 [22-400]  7.79998304125571e-30 SSF50952
SSF50952   Quino_gluc_DH
IPR011042 Six-bladed beta-propeller, TolB-like (Domain)
 [26-390]  4.80000000000003e-93 G3DSA:2.120.10.30
G3DSA:2.120.10.30   6-blade_b-propeller_TolB-like
IPR012291 Cellulose-binding family II/chitobiase, carbohydrate-binding domain (Domain)
 [393-494]  1.99999999999999e-37 G3DSA:2.60.40.290
G3DSA:2.60.40.290   CBD_carb_bd
IPR012938 Glucose/Sorbosone dehydrogenase (Domain)
 [52-383]  4.6e-44 PF07995
PF07995   GSDH
SignalP
 [1-25]  0.727 Signal
Eukaryota   
 [1-25]  0.74 Signal
Bacteria, Gram-positive   
 [1-25]  0.804 Signal
Bacteria, Gram-negative   
TMHMM No significant hit