close all open/close all
Chlor_00390 Chlor_00390   last last

CDS information : Chlor_00400


close this sectionLocation

Organism
StrainA82846UV37B
Entry nameChloroeremomycin
Contig
Start / Stop / Direction72,172 / 71,774 / - [in whole cluster]
37,928 / 37,530 / - [in contig]
Locationcomplement(71774..72172) [in whole cluster]
complement(37530..37928) [in contig]
TypeCDS
Length399 bp (132 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)PCZA361.28
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chloroeremomycin biosynthesis.
Note (GenBank)
  • similar to sugar transporter

close this sectionSequence

selected fasta
>[PCZA361.28]
MFQLPFALFMMRNSFEAVPRELDEAALVDGCGPLRVLWSVLLPAVVPGMVTVGLFAFLAS
WNEFIAPLIFLSDGDKFTLPTALAAMRSGNFGAIDYGALQAGIVVSAIPCMILFMLLQRH
YVRGFSSGALKG
selected fasta
>[PCZA361.28]
ATGTTCCAGCTTCCGTTCGCGTTGTTCATGATGCGCAACTCGTTCGAGGCCGTGCCACGA
GAACTCGACGAGGCCGCACTGGTCGACGGCTGCGGGCCGCTGCGGGTGCTGTGGTCGGTG
CTGCTTCCCGCCGTGGTGCCAGGCATGGTCACGGTTGGCTTGTTCGCGTTCTTGGCCTCG
TGGAACGAGTTCATCGCGCCGCTGATCTTTCTGTCCGACGGCGACAAGTTCACGTTGCCC
ACTGCTCTGGCCGCGATGCGTTCCGGCAACTTCGGGGCCATCGACTACGGGGCGCTGCAA
GCCGGGATCGTGGTGTCGGCGATCCCGTGCATGATCCTTTTCATGCTGCTGCAACGGCAT
TACGTCCGCGGCTTCAGCTCAGGCGCGCTGAAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [2-124]  8.59999999999999e-19 PF00528
PF00528   BPD_transp_1
 [1-117]  PS50928
PS50928   ABC_TM1
SignalP No significant hit
TMHMM
 [36-58]  Transmembrane (o-i) [96-118]  Transmembrane (i-o)
Transmembrane 2   
Chlor_00390 Chlor_00390   last last