close all open/close all

CDS information : Chro_00040


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction2,050 / 3,432 / + [in whole cluster]
2,050 / 3,432 / + [in contig]
Location2050..3432 [in whole cluster]
2050..3432 [in contig]
TypeCDS
Length1,383 bp (460 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)NDP-2,3-dehydratase
Gene
Gene (GenBank)cmmV
EC number
Keyword
  • D-olivose
  • D-oliose
  • L-chromose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-2,3-dehydratase]
MAQAATRTARDRAVHRYGPRLAHSAQAGDRAGGIPGWLDERRRSGTFEVRRIPFGEMVKW
RIDPDTGNLVHDSGRFFSIEGLTVRADSGTTWSQPIINQPETGVLGILVKEIDGVLRFLM
QAKMEPGNIGLFQLGPTVQATRSNYTGVHRGRPTPYIEYFVGERRGEVLTDVLQSEQGDS
FLRKRNRNMVVEITEDIEVRDDYRWLTLGEIHQLLAVDNLVNMDARTVLSSLPFPPGDED
AAPHSDTEILSWLTGIKTRHEREVVTSPLARIEDWRRTPAEIARSDGRHLRVLAVSVQAG
NREVTNWTQPLLAAQRQGIAAFIVRRTAGEPQVLVQGLTQPGTFDVAEMAPTVQCVTDGW
HDLPEKPPYLDYVLAVPDDRVHYSALLSEEGGRFYRRDNRYLVVEADETLGGDPPDAYRW
LGFSQLKRFTGYSNHVDVEARTLIACLQSLWGKEPLWARG
selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-2,3-dehydratase]
ATGGCTCAGGCAGCGACACGGACGGCCCGGGACCGGGCCGTCCACCGGTACGGTCCCCGG
CTGGCCCATTCGGCCCAGGCCGGCGACCGAGCCGGCGGGATACCCGGCTGGCTCGACGAA
CGCCGGCGGTCCGGCACGTTCGAGGTCCGGCGCATCCCCTTCGGCGAGATGGTGAAATGG
CGGATCGACCCGGACACCGGGAACCTGGTGCACGACAGCGGACGCTTCTTCTCGATCGAG
GGCCTGACGGTCCGTGCGGACTCCGGCACCACATGGTCCCAGCCGATCATCAACCAGCCC
GAGACCGGGGTGCTCGGCATCCTCGTCAAGGAGATCGACGGTGTCCTGCGGTTCCTGATG
CAGGCCAAGATGGAGCCCGGGAACATCGGCCTGTTCCAGCTCGGCCCCACCGTCCAGGCC
ACGCGCAGCAACTACACCGGAGTGCACCGGGGGCGGCCCACCCCCTACATCGAGTACTTC
GTGGGGGAGCGGCGCGGCGAGGTGCTCACGGACGTGCTCCAGTCCGAACAGGGCGACAGC
TTCCTGCGCAAGCGCAACCGCAACATGGTCGTGGAGATCACCGAGGACATCGAGGTCCGC
GACGACTACCGCTGGCTCACCCTGGGCGAGATCCATCAGCTCCTCGCGGTGGACAACCTC
GTCAACATGGACGCCCGCACGGTTCTGTCGTCGCTGCCGTTCCCCCCGGGGGACGAGGAC
GCGGCTCCGCACAGCGACACCGAGATCCTGAGCTGGCTCACCGGGATCAAGACCCGCCAC
GAACGGGAGGTCGTCACCTCGCCGCTCGCCCGGATCGAGGACTGGCGGCGCACACCGGCG
GAGATCGCCCGCAGCGACGGCCGCCACCTGCGGGTGCTCGCCGTCTCCGTACAGGCGGGA
AACCGCGAGGTGACCAACTGGACACAGCCGTTGCTGGCCGCCCAGCGCCAGGGCATTGCC
GCATTCATCGTCCGGCGTACCGCGGGCGAGCCGCAGGTCCTCGTCCAGGGACTCACCCAG
CCCGGCACCTTCGACGTCGCCGAGATGGCGCCGACCGTGCAGTGCGTCACGGACGGCTGG
CACGATCTGCCGGAGAAGCCGCCCTACCTGGACTACGTGCTCGCCGTACCCGACGACCGT
GTGCACTACTCGGCGCTGCTGTCCGAGGAGGGCGGCAGGTTCTACCGGCGCGACAACCGC
TATCTCGTCGTCGAGGCCGACGAGACCCTCGGCGGTGACCCGCCCGACGCCTACCGGTGG
CTGGGGTTCTCCCAGCTCAAGCGGTTCACCGGTTACAGCAATCACGTGGACGTGGAGGCG
CGCACCCTGATCGCCTGCCTCCAGTCCCTCTGGGGCAAGGAGCCGCTGTGGGCCCGAGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [34-232]  3.30000000000002e-80 PF03559 [244-447]  2.59999999999995e-69 PF03559
PF03559   Hexose_dehydrat
SignalP
 [1-27]  0.413 Signal
Bacteria, Gram-negative   
TMHMM No significant hit