close all open/close all

CDS information : Chro_00050


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction3,417 / 4,427 / + [in whole cluster]
3,417 / 4,427 / + [in contig]
Location3417..4427 [in whole cluster]
3417..4427 [in contig]
TypeCDS
Length1,011 bp (336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)NDP-3-ketoreductase
Gene
Gene (GenBank)cmmW
EC number
Keyword
  • D-olivose
  • D-oliose
  • L-chromose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [NDP-3-ketoreductase]
MGPRLRVGVLGCASIARRKMLPALASNPSVRLVAVASRTGEKATMFAAPYGCDAVTGYEE
LLQRTDVDAVYIPLPAALRATWIARALEAGKHVLGEKPLTTTAADARDLVALGGRRGLLL
MESFMFLHHSVHRRVTELVAAGRIGEPRSFTAEFTIPPLPADDIRNRPGLGGGALLDLGV
YTVRAAQYFCGPGLSVAGAVLMSDPPVAGAPPATGRGVDRAGAALLTSDRTTAQLTFGIA
HAYQCRYRICGSEGLLSLDRAFTPPPNLRPVVRIEDKDGTEERALEADDHFANIVTAFAG
TALGGGDLTGHGEQILRQADLVERIRRAGAPAPRAA
selected fasta
>putative NDP-hexose C-3 ketoreductase [NDP-3-ketoreductase]
GTGGGCCCGAGGCTGAGGGTCGGCGTACTCGGCTGCGCCTCCATCGCCCGCCGCAAGATG
CTGCCCGCCCTGGCGTCGAACCCGTCGGTCCGACTGGTGGCGGTGGCCAGCCGCACCGGC
GAGAAGGCGACCATGTTCGCGGCTCCCTACGGGTGCGATGCGGTCACGGGCTACGAGGAA
CTGCTGCAGCGCACCGACGTCGACGCCGTGTACATCCCGCTGCCCGCCGCACTGCGGGCC
ACCTGGATCGCGCGCGCTCTGGAAGCCGGCAAACACGTCCTCGGAGAGAAACCCCTCACC
ACGACCGCCGCCGACGCCCGGGACTTGGTGGCCCTCGGCGGACGGCGGGGACTGCTGCTG
ATGGAGAGCTTCATGTTCCTCCACCACTCCGTCCACCGGCGCGTCACCGAACTCGTCGCC
GCCGGACGCATCGGCGAACCACGCTCGTTCACCGCCGAGTTCACCATCCCGCCGCTTCCC
GCCGATGACATCCGCAACCGTCCTGGCCTCGGCGGCGGCGCCCTGCTCGACCTGGGCGTC
TACACCGTCCGGGCGGCGCAGTACTTCTGCGGCCCCGGCCTGTCCGTGGCGGGCGCGGTG
CTCATGAGCGACCCGCCCGTGGCAGGCGCGCCCCCGGCCACCGGCCGCGGGGTCGACCGG
GCGGGGGCGGCGCTGCTGACCTCGGACCGGACCACCGCCCAGCTGACCTTCGGCATAGCC
CACGCCTACCAGTGCCGTTACCGCATCTGCGGCAGCGAGGGCCTCCTCTCACTGGACCGG
GCGTTCACCCCGCCGCCCAACCTGCGGCCCGTGGTGCGCATCGAGGACAAGGACGGCACC
GAGGAACGGGCACTCGAGGCCGACGACCACTTCGCCAACATCGTCACGGCCTTCGCCGGC
ACCGCCCTGGGCGGCGGTGACCTCACCGGGCATGGGGAGCAGATCCTCCGCCAGGCCGAC
CTGGTGGAGCGCATCCGACGGGCGGGTGCTCCCGCCCCCCGCGCCGCATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [5-121]  9.5e-25 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [137-249]  1.4e-08 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [3-146]  1.80000000000002e-43 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-25]  0.509 Signal
Bacteria, Gram-negative   
 [1-36]  0.605 Signal
Bacteria, Gram-positive   
TMHMM No significant hit