close all open/close all

CDS information : Chro_00070


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction5,703 / 8,102 / + [in whole cluster]
5,703 / 8,102 / + [in contig]
Location5703..8102 [in whole cluster]
5703..8102 [in contig]
TypeCDS
Length2,400 bp (799 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative biotin carboxylase/putative oxidoreductase
Product (GenBank)oxygenase
Gene
Gene (GenBank)cmmOI
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
  • bifunctional protein
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
P49787
PmId
[7592499] The genes encoding the biotin carboxyl carrier protein and biotin carboxylase subunits of Bacillus subtilis acetyl coenzyme A carboxylase, the first enzyme of fatty acid synthesis. (J Bacteriol. , 1995)
ACC
Q70DW2
NITE
Resis_00160
PmId
[17090047] The boat-shaped polyketide resistoflavin results from re-facial central hydroxylation of the discoid metabolite resistomycin. (J Am Chem Soc. , 2006)
ACC
Q3S8R0
NITE
Oxtet_00060
PmId
[18422316] Identifying the minimal enzymes required for anhydrotetracycline biosynthesis. (J Am Chem Soc. , 2008)
[19472250] Identification of OxyE as an ancillary oxygenase during tetracycline biosynthesis. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>putative biotin carboxylase/putative oxidoreductase [oxygenase]
MSTGDGMSTGGGTRAGDGPGGREGCLAVLIKAVLRTGVQALHPGYGFASENPDLAEVRED
HGSTSVGPSAPVIDRLGDKVSARALMAEAGLPLLPGGVEPAAGLEEARALAVETGYPLVI
KPVAGGGGRDTQVVRGPGEPAAKYRQPRGKAQGLFGDNRVYPECYRAAARHVEIQVFGDQ
LGNLVHLGEAALLGAKAAEYTGAGTFDFLVDDTGDFYSMEVNCRIQVEHPVTEVVTGVDL
VRERFRVAARLPLELSQSGVAPRGAAIECRQRHGPRPRPPADARPGRGVHRSGGTVRPSG
HGLLPRAPRIGGQRPVAGQGDHLGPRPRAGPGEDAPGTGRIPRERSRSAYEHPLPAPRAG
RSAFRRRHPHHVAHRGPHLTGAPRMTIDQTPRATGSTTDVCVIGGGPAGLTLALLLLRSG
VQVTLVERATSMSREYRGEILQPGGLALLDQLGVLAPAAARGGYWLDGFQLVERERVLLD
IAYDRLPAPYNRLLSVPQRHVLAELLDRCHGFDGFRYLDGHRLSALVEEDGAVRGAVAEG
RAGPHTVRAGWVVGADGRFSKTRRLAGIGADRQDVFAFDVLWFKLPQEEPPGRHVRVFRA
AGRPVLVYPSYPGTVQLGWTLPHKGYAEMATLGVETIRSEIARAVPAYADRLARHVHALS
DFTLLDVFAGRAREWVRDGLVLIGDSAHTHSPLGAQGINLALQDAALLHPVLVEALRDGD
FSAGRLDAYALPRSRDIDQVMKTQTMQAKAMLSQGRVARVVRPRLAGLVQRTPIGPKITR
HIALGNPAARVRSDLFAPG
selected fasta
>putative biotin carboxylase/putative oxidoreductase [oxygenase]
ATGAGCACCGGGGACGGCATGAGCACCGGGGGCGGGACGAGGGCGGGAGACGGCCCGGGC
GGGCGCGAGGGGTGTCTCGCGGTACTCATCAAGGCGGTCCTACGCACTGGGGTCCAGGCC
CTGCATCCCGGCTACGGATTCGCCTCCGAGAACCCCGACCTCGCCGAGGTCCGCGAGGAC
CACGGCAGCACTTCCGTCGGCCCGTCCGCGCCCGTCATCGACCGGCTGGGCGACAAGGTC
AGCGCTCGCGCGCTGATGGCCGAGGCCGGGCTGCCCCTGCTCCCCGGCGGTGTCGAACCG
GCGGCCGGCCTTGAGGAGGCCCGCGCCCTCGCCGTGGAGACCGGCTACCCGCTCGTCATC
AAACCGGTGGCCGGTGGGGGCGGCCGGGACACGCAGGTGGTGCGCGGCCCCGGCGAGCCG
GCGGCCAAGTACCGTCAGCCACGCGGCAAGGCGCAGGGCCTGTTCGGGGACAACCGGGTC
TATCCGGAGTGCTACCGCGCCGCCGCCCGGCACGTCGAGATCCAGGTGTTCGGTGACCAG
CTGGGCAATCTCGTCCACCTGGGGGAGGCGGCGCTGCTCGGGGCCAAGGCCGCCGAGTAC
ACAGGGGCGGGCACCTTCGACTTCCTGGTGGACGACACCGGCGACTTCTACTCTATGGAG
GTCAACTGCCGTATCCAGGTGGAACATCCCGTGACCGAGGTGGTCACCGGGGTGGACCTG
GTGCGCGAGCGGTTCCGGGTCGCGGCCCGTCTGCCGCTGGAACTCTCCCAGTCCGGCGTC
GCCCCGCGCGGTGCCGCGATCGAGTGCCGTCAACGCCATGGACCCCGCCCGCGACCTCCC
GCCGACGCACGGCCCGGTCGAGGAGTTCACCGCTCCGGCGGGACCGTTCGTCCTAGTGGA
CACGGACTGCTTCCCCGGGCACCGCGTATCGGCGGCCAACGACCCGTTGCCGGCCAAGGT
GATCACCTGGGCCCCCGACCGCGCGCAGGCCCGGGAGAGGATGCGCCGGGCACTGGACGC
ATTCCACGTGAACGGTCCCGGAGTGCGTACGAACATCCCCTTCCTGCGCCGCGTGCTGGA
CGCTCCGCGTTTCGCCGACGGCACCCACACCACGTCGCTCATCGCGGACCTCACCTCACA
GGAGCCCCTCGGATGACCATCGACCAGACCCCCCGCGCGACCGGCTCCACGACGGACGTC
TGTGTCATCGGCGGAGGCCCCGCCGGGCTGACCCTCGCCCTGCTCCTGCTCCGCTCCGGA
GTACAGGTCACCCTCGTCGAACGCGCGACCTCCATGTCGCGTGAGTACCGGGGCGAGATA
CTCCAGCCCGGCGGGCTGGCCCTGCTCGACCAGCTCGGCGTGCTGGCACCCGCCGCCGCG
CGCGGCGGGTACTGGCTGGACGGATTCCAGCTGGTGGAACGCGAGCGGGTGCTCCTCGAC
ATCGCCTACGACCGGCTGCCCGCGCCGTACAACCGCCTGCTCAGTGTTCCGCAGCGGCAC
GTACTGGCGGAACTGCTCGACCGCTGCCACGGGTTCGACGGCTTCCGCTATCTCGACGGA
CACCGGCTGAGCGCGCTCGTCGAGGAGGACGGAGCCGTCCGCGGTGCCGTCGCCGAGGGC
CGGGCCGGTCCCCACACCGTGCGTGCCGGATGGGTCGTCGGCGCCGACGGACGGTTCTCC
AAGACCCGGCGGCTCGCCGGGATCGGAGCCGATCGGCAGGACGTGTTCGCCTTCGACGTG
CTGTGGTTCAAACTGCCGCAGGAGGAACCACCCGGCCGGCACGTGCGCGTCTTCCGGGCC
GCGGGCCGGCCGGTGCTCGTCTACCCTTCGTACCCCGGCACCGTGCAGCTCGGCTGGACC
CTGCCGCACAAGGGGTACGCCGAGATGGCCACGCTCGGCGTCGAAACGATCAGGTCCGAG
ATCGCCCGCGCGGTCCCCGCGTACGCCGACCGGCTCGCCCGGCACGTCCACGCGCTCTCC
GACTTCACCCTGCTGGACGTCTTCGCCGGACGCGCGCGGGAGTGGGTGCGCGACGGCCTC
GTCCTGATCGGGGACAGCGCGCACACCCACAGCCCGCTCGGCGCCCAGGGCATCAACCTC
GCGCTTCAGGACGCCGCCCTGCTGCACCCCGTCCTCGTGGAGGCGTTGCGCGACGGCGAC
TTCTCGGCCGGACGGCTGGACGCCTACGCACTGCCGCGCTCCCGTGACATCGACCAGGTG
ATGAAGACACAGACGATGCAGGCCAAGGCGATGCTCTCGCAGGGCCGGGTGGCCCGGGTG
GTGCGTCCCCGGCTGGCCGGCCTCGTCCAGCGCACGCCCATCGGCCCGAAGATCACCCGG
CACATCGCGCTGGGCAACCCGGCCGCACGGGTGCGCTCCGACCTGTTCGCCCCCGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [398-741]  1.3e-44 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [399-421]  5e-23 PR00420 [548-563]  5e-23 PR00420 [677-692]  5e-23 PR00420 [692-708]  5e-23 PR00420
PR00420   RNGMNOXGNASE
IPR005479 Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domain (Domain)
 [78-189]  4.5e-20 PF02786
PF02786   CPSase_L_D2
IPR005481 Carbamoyl-phosphate synthase, large subunit, N-terminal (Domain)
 [29-73]  1.5e-07 PF00289
PF00289   CPSase_L_chain
IPR011761 ATP-grasp fold (Domain)
 [83-300]  14.253 PS50975
PS50975   ATP_GRASP
IPR011764 Biotin carboxylation domain (Domain)
 [1-799]  14.543 PS50979
PS50979   BC
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [93-163]  6.3e-13 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   no description
IPR013816 ATP-grasp fold, subdomain 2 (Domain)
 [188-270]  8.2e-25 G3DSA:3.30.470.20
G3DSA:3.30.470.20   no description
IPR016185 Pre-ATP-grasp fold (Domain)
 [29-76]  1.8e-14 SSF52440
SSF52440   PreATP-grasp domain
 [29-92]  1.7e-15 G3DSA:3.40.50.20
G3DSA:3.40.50.20   no description
SignalP
 [1-40]  0.346 Signal
Eukaryota   
 [1-48]  0.284 Signal
Bacteria, Gram-negative   
TMHMM No significant hit