close all open/close all

CDS information : Chro_00090


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction9,959 / 8,691 / - [in whole cluster]
9,959 / 8,691 / - [in contig]
Locationcomplement(8691..9959) [in whole cluster]
complement(8691..9959) [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)ketosynthase
Gene
Gene (GenBank)cmmK
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q54496
NITE
Nogl_00380
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
ACC
Q54174
NITE
Urd_00130
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

CLF5..360

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [ketosynthase]
MRPPALTGMGVLAPNGAGQQAYWAATLRGENGIGRITRFDPASYPARLAGEIGGFDASAE
LPNRLIPQTDEVTRLSLVAAGWALADAALDPAALPEYAMGVVTANTAGGFEFGQRELENL
WSKGSGHVSAYQSFAWFYAVNTGQVSIRHGLRGPGSVVVADGAGGLDALAQARRMIRGGT
PLVLGGAVDGSLCPWSWTAQLTVGRLSTREDPADAYLPFDARACGHVLGEGGALLVVEDQ
DSARARGARVHGLLDGCASTFDPRPGTGRPPGLERAVRRALEDAAWDPADVDVVFADAAG
SPGPDREEADALAAVFGPHGVPVTAPKTMTGRLAAGSGPLDVATALLSFADQVIPPTVHV
REPVQAYRLDLVTAPRRVPLRRALVLGRGHGGFNSVVAVSAPPEAGPVPSPSGTSARTTL
GA
selected fasta
>polyketide synthase chain length factor subunit [ketosynthase]
ATGAGACCCCCCGCACTCACCGGCATGGGCGTACTGGCCCCCAACGGGGCGGGCCAGCAG
GCCTACTGGGCCGCAACCCTGCGGGGCGAGAACGGGATCGGGCGGATCACCCGGTTCGAC
CCTGCGTCCTACCCCGCCAGGCTGGCCGGGGAGATCGGCGGGTTCGATGCGTCGGCCGAG
CTGCCCAACCGGCTGATCCCGCAGACCGACGAGGTGACCCGGCTGTCCCTGGTGGCCGCG
GGCTGGGCGCTCGCCGATGCCGCGCTCGACCCCGCGGCCCTGCCCGAATACGCCATGGGT
GTCGTCACCGCCAATACGGCGGGCGGATTCGAGTTCGGCCAGCGGGAGCTGGAGAACCTG
TGGTCCAAGGGCAGCGGTCATGTGAGCGCCTATCAGTCCTTCGCCTGGTTCTACGCCGTC
AACACGGGGCAGGTCTCCATCCGGCACGGCCTGCGCGGGCCCGGTTCCGTCGTGGTGGCC
GACGGGGCCGGCGGCCTCGATGCCCTCGCCCAGGCCCGCCGGATGATCCGCGGCGGCACA
CCCCTGGTGCTGGGCGGTGCGGTGGACGGTTCGCTGTGCCCGTGGAGCTGGACGGCCCAG
CTGACGGTCGGGCGCCTCAGCACCCGCGAGGACCCCGCCGACGCCTACCTCCCCTTCGAC
GCCCGCGCCTGCGGACACGTGCTCGGGGAGGGCGGCGCCCTGCTGGTCGTCGAGGACCAG
GACTCCGCCCGGGCGCGCGGCGCCCGTGTCCACGGGCTGTTGGACGGCTGTGCGTCCACC
TTCGACCCCCGGCCGGGGACGGGCCGCCCGCCCGGTCTGGAACGGGCGGTGCGCCGGGCC
CTGGAGGATGCGGCCTGGGATCCGGCCGACGTGGACGTGGTCTTCGCGGACGCGGCGGGC
AGCCCGGGACCCGACCGGGAGGAGGCGGACGCCCTCGCCGCCGTGTTCGGCCCGCACGGT
GTGCCGGTCACCGCGCCGAAGACAATGACGGGGCGGCTGGCGGCGGGGAGCGGCCCGCTG
GACGTGGCGACCGCCCTGCTCTCCTTCGCCGACCAGGTGATCCCGCCGACGGTGCATGTG
CGCGAACCGGTCCAGGCCTACCGGCTCGACCTCGTCACCGCGCCCCGGCGGGTGCCGCTG
CGCCGTGCGCTAGTCCTCGGCCGGGGGCACGGCGGGTTCAACTCCGTGGTAGCGGTGTCG
GCGCCGCCCGAGGCGGGTCCGGTCCCCTCCCCCTCGGGAACATCGGCCCGAACCACACTC
GGGGCCTGA
CLF5..360
CLF13..1080

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [5-241]  5.30000000000001e-47 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [254-360]  1.8e-25 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [5-254]  1.70000000000001e-49 G3DSA:3.40.47.10 [268-402]  4.80000000000003e-37 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-248]  4.79998722798115e-58 SSF53901 [211-402]  2.69998997787809e-46 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-18]  0.792 Signal
Eukaryota   
 [1-19]  0.62 Signal
Bacteria, Gram-negative   
TMHMM No significant hit