close all open/close all

CDS information : Chro_00100


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction11,224 / 9,956 / - [in whole cluster]
11,224 / 9,956 / - [in contig]
Locationcomplement(9956..11224) [in whole cluster]
complement(9956..11224) [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)ketosynthase
Gene
Gene (GenBank)cmmP
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q54495
NITE
Nogl_00370
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
ACC
Q54173
NITE
Urd_00120
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS3..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketosynthase]
MNRRVVLTGIGVVAPGGTGTKAFWELITSGGTATRPISLFDASPFRSRIAAECDFDPAAH
GLTHKETRRMDRAAQFAAVATDEAVADAGLEFHRTDPARVGVTVGSAVGCTTSLEREYTA
VSDGGRDWLVDHTYAVPHLYDHLVPSSMAAEVAWRVRAEGPASVVSTGCTSGLDAVAHAR
GLILEGSADVMVAGATDAPISPITLACFDAIKATTPRNDDPEHASRPFDATRNGFVLGEG
SAMFVLEEYEHAVRRGARPYAEITGFASRCNAFHMTGLRPDGREMAEAIGRALAEAGARP
DDIDYVNAHGSGTKQNDRHETAAFKAALGEHAYAVPVSSIKSMVGHSLGAIGAIEIAACA
LAVRHGVVPPTANLHEPDPECDLDYVPLRARHRALDRVLTVGSGFGGFQSAMVLAAPEER
AS
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [ketosynthase]
ATGAACAGGCGTGTCGTCCTCACGGGAATCGGTGTGGTGGCCCCCGGCGGCACGGGCACC
AAGGCGTTCTGGGAGCTGATCACCTCCGGGGGCACGGCGACCCGGCCGATCTCCCTCTTC
GACGCCTCCCCGTTCCGGTCGCGGATCGCCGCCGAGTGCGACTTCGACCCCGCCGCGCAC
GGACTGACCCACAAGGAGACCCGGCGGATGGACCGAGCCGCCCAGTTCGCAGCGGTCGCC
ACCGACGAGGCCGTCGCCGACGCCGGACTGGAGTTCCACCGCACCGACCCCGCACGGGTG
GGAGTCACGGTCGGCAGCGCGGTCGGCTGCACCACCAGCCTGGAACGCGAGTACACCGCG
GTCAGCGACGGCGGCCGGGACTGGCTCGTCGACCACACCTACGCCGTACCCCACCTCTAC
GACCACCTCGTCCCGAGCTCGATGGCCGCCGAAGTGGCCTGGCGGGTACGTGCCGAGGGC
CCCGCCTCGGTCGTCTCGACCGGCTGCACCTCCGGGCTCGACGCGGTCGCCCACGCCCGC
GGCCTGATCCTGGAGGGCAGCGCCGACGTGATGGTGGCCGGCGCGACCGACGCGCCGATC
TCCCCGATCACCCTGGCCTGCTTCGACGCCATCAAGGCGACCACCCCGCGCAACGACGAC
CCGGAGCACGCCTCACGTCCCTTCGACGCCACCCGGAACGGCTTCGTGCTGGGCGAGGGA
TCCGCGATGTTCGTCCTGGAGGAGTACGAGCACGCGGTACGCCGAGGGGCGCGCCCCTAC
GCCGAGATCACCGGCTTCGCCTCCCGCTGCAACGCCTTCCACATGACGGGCCTGCGCCCG
GACGGCAGGGAGATGGCCGAGGCCATCGGGCGGGCGCTCGCCGAGGCGGGGGCCCGCCCC
GACGACATCGACTACGTGAACGCGCACGGCTCGGGCACCAAGCAGAACGACCGGCACGAG
ACGGCCGCCTTCAAGGCCGCGCTCGGCGAGCACGCGTACGCCGTCCCCGTCAGTTCCATC
AAGTCGATGGTGGGGCACTCGCTCGGGGCGATCGGCGCGATCGAGATCGCCGCCTGTGCG
CTGGCCGTCCGGCACGGCGTCGTCCCGCCGACCGCCAATCTGCACGAGCCCGACCCCGAG
TGCGACCTGGACTACGTGCCGCTGCGCGCCCGGCACCGGGCGCTGGACAGGGTGCTGACC
GTGGGCAGCGGATTCGGCGGCTTCCAGAGCGCCATGGTGCTCGCCGCCCCCGAGGAGCGT
GCGTCATGA
KS3..375
KS7..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-251]  3.40000000000004e-60 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-375]  6.40000000000004e-40 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-265]  3.79999999999991e-65 G3DSA:3.40.47.10 [270-418]  4.6e-55 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-419]  7.80005155399507e-70 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-19]  0.845 Signal
Eukaryota   
TMHMM No significant hit