close all open/close all

CDS information : Chro_00110


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction12,201 / 11,221 / - [in whole cluster]
12,201 / 11,221 / - [in contig]
Locationcomplement(11221..12201) [in whole cluster]
complement(11221..12201) [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)NDP-4,6-dehydratase
Gene
Gene (GenBank)cmmE
EC number4.2.1.46
Keyword
  • D-olivose
  • D-oliose
  • L-chromose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q56173
NITE
Grana_00110
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [NDP-4,6-dehydratase]
MRVLVTGGAGFIGSHYVRSLLSGAYAGYERAHVTVLDRLTYAGSTANLPMTHPRLTLVRG
DVCDRRPLLDLLPEHDAVVHFAAESHVDRSIHDASLFARTNVVGTQNLLDCCVRTGVRKV
VHVSTDEVYGSIDEGSWTEDHPLEPNSPYAASKAGADLMARAYGRTHGLDVSVTRCSNNY
GPHQHPEKLLPHFITRLLDGLQVPLYGDGRHVREWIHVDDHCRAVQLVLDKGAPGAAYNI
AGVARSNEDMTRDLLRLCGADWSRVRRVEDRKGHDRRYAVDDSLIRDTLGFTPRIPLEAG
LAGLVDWYRAHRAWWQPLTRTAQEAR
selected fasta
>putative dTDP-glucose 4,6-dehydratase [NDP-4,6-dehydratase]
ATGAGGGTCCTCGTCACCGGCGGCGCCGGTTTCATCGGGTCGCACTATGTGCGCAGCCTG
CTGTCCGGCGCCTACGCCGGGTACGAGCGAGCCCACGTCACCGTGCTGGACAGACTCACC
TACGCGGGCAGCACCGCCAACCTGCCGATGACCCACCCCCGGCTGACCCTGGTCCGGGGC
GACGTCTGCGACCGGCGACCGCTGCTCGATCTGCTGCCGGAACACGACGCGGTGGTGCAC
TTCGCGGCCGAGTCGCACGTGGACCGCTCCATCCACGACGCCTCCCTCTTCGCCCGTACG
AACGTGGTCGGCACCCAGAACCTGCTCGACTGCTGCGTGCGCACCGGTGTGCGGAAGGTG
GTGCACGTGTCGACCGACGAGGTCTACGGCTCCATCGACGAGGGCTCCTGGACGGAGGAC
CATCCGCTGGAACCCAACTCCCCCTACGCCGCCTCGAAGGCGGGGGCGGACCTCATGGCC
CGCGCCTACGGGCGCACCCACGGGCTCGACGTCTCGGTCACCCGCTGCTCCAACAACTAC
GGCCCCCACCAGCACCCGGAGAAGCTGCTCCCGCACTTCATCACCCGGCTCCTGGACGGG
CTCCAGGTGCCGCTGTACGGGGACGGCCGCCACGTACGCGAATGGATCCACGTGGACGAC
CACTGCCGCGCCGTCCAGCTCGTCCTGGACAAGGGAGCGCCGGGCGCGGCCTACAACATC
GCCGGCGTCGCGCGGTCCAACGAGGACATGACCCGCGACCTGCTGCGCCTGTGCGGCGCC
GACTGGAGCCGGGTGCGCAGGGTCGAGGACCGCAAGGGCCACGACCGGCGGTACGCGGTG
GACGACTCCCTGATCCGCGACACGCTCGGCTTCACACCCCGTATCCCGCTCGAAGCCGGA
CTGGCCGGCCTCGTCGACTGGTACCGCGCCCACCGGGCGTGGTGGCAACCGCTCACCCGC
ACCGCCCAGGAGGCCAGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-241]  5.40000000000002e-68 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-318]  7.5e-116 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-188]  6.49999999999992e-69 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [136-164]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-19]  0.327 Signal
Eukaryota   
TMHMM No significant hit