close all open/close all

CDS information : Chro_00120


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction13,265 / 12,198 / - [in whole cluster]
13,265 / 12,198 / - [in contig]
Locationcomplement(12198..13265) [in whole cluster]
complement(12198..13265) [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)NDP-glucose synthase
Gene
Gene (GenBank)cmmD
EC number2.7.7.24
Keyword
  • D-olivose
  • D-oliose
  • L-chromose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q2HR55
NITE
Sch475_00270
PmId
[18051285] Cloning and expression of glucose-1-phosphate thymidylyltransferase gene (schS6) from Streptomyces sp. SCC-2136. (J Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-glucose synthase]
MKALVLAGGMGTRLRPLTHSMPKQLVPLANKPVLCHALEDIARAGVTDVGIIVGDWHKEI
EEAVGDGGRFGLRITYLPQEAPFGLAHCVLVAREFLADDDFLMYLGDNVFADGVHALADA
FRRDRPAAQVAVTAVDSPQEYGVAVTTSDGRVLGLQEKPREPRSDLAVTGAYFFTPEIHD
AIARIRPSTRGEWEITDAIQALIDRGSEVRAVRLSDWWKDTGRVEDILDCNQLLLDHVTT
SVRGSVDAASTVLGPVVVEPGARIIRSHLRGPLIVGAGCVVEDSYVGPYSAVGANCALTD
AGISHSIMLQDATVTDVNGIHRSVIGRSARVGAPVNGTGRHRLVVGDHTELEVVA
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-glucose synthase]
GTGAAGGCTCTGGTTCTGGCCGGCGGAATGGGGACGCGGCTGCGCCCGCTCACCCACTCC
ATGCCGAAACAGCTGGTCCCCCTCGCGAACAAACCGGTGCTGTGCCACGCCCTGGAGGAC
ATCGCGCGGGCCGGTGTCACGGACGTCGGCATCATCGTGGGGGACTGGCACAAGGAGATC
GAGGAGGCGGTGGGGGACGGCGGGCGCTTCGGCCTGCGGATCACCTACCTGCCCCAGGAG
GCGCCCTTCGGCCTGGCCCACTGCGTACTGGTCGCGCGGGAGTTCCTGGCGGACGACGAC
TTCCTGATGTACCTCGGGGACAACGTCTTCGCCGACGGCGTCCACGCGCTCGCCGACGCC
TTCCGCCGGGACCGGCCGGCCGCCCAGGTCGCCGTGACCGCCGTGGACAGCCCCCAGGAG
TACGGCGTCGCCGTGACCACCTCGGACGGCCGGGTGCTCGGACTCCAGGAGAAGCCGCGC
GAGCCGAGGAGCGACCTCGCCGTGACCGGCGCCTACTTCTTCACCCCGGAGATCCACGAC
GCCATCGCCCGCATCCGGCCCAGCACACGCGGCGAGTGGGAGATCACCGACGCCATCCAG
GCCCTGATCGACCGGGGCAGCGAGGTGCGGGCGGTGCGGCTGTCCGACTGGTGGAAGGAC
ACCGGGCGCGTGGAGGACATCCTCGACTGCAATCAGCTCCTGCTCGACCACGTCACGACG
TCCGTCCGCGGTTCCGTTGACGCGGCGAGCACTGTGCTCGGTCCGGTCGTGGTCGAGCCC
GGCGCCCGCATCATCCGCTCGCACCTGCGCGGACCGCTGATCGTCGGCGCGGGCTGCGTG
GTCGAGGACAGCTATGTCGGCCCGTACTCCGCCGTCGGCGCGAACTGCGCCCTCACCGAC
GCGGGCATCTCCCACTCGATCATGCTGCAGGACGCGACCGTCACCGACGTCAACGGCATC
CACCGCTCGGTCATCGGCCGCTCAGCCCGGGTGGGCGCCCCCGTGAACGGCACGGGACGC
CACCGGCTCGTGGTGGGCGACCACACCGAACTCGAAGTCGTCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-235]  5.69999999999998e-53 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-352]  2.20000000000002e-124 TIGR01208
TIGR01208   RmlA_long
SignalP
 [1-20]  0.586 Signal
Eukaryota   
TMHMM No significant hit