close all open/close all

CDS information : Chro_00130


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction13,459 / 14,211 / + [in whole cluster]
13,459 / 14,211 / + [in contig]
Location13459..14211 [in whole cluster]
13459..14211 [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-oliose C-4' O-methyltransferase
Product (GenBank)sugar O-methyltransferase
Gene
Gene (GenBank)cmmMIII
EC number2.1.1.-
Keyword
  • disaccharide 2nd D-oliose
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
[15255901] Tailoring modification of deoxysugars during biosynthesis of the antitumour drug chromomycin A by Streptomyces griseus ssp. griseus. (Mol Microbiol. , 2004)
Related Reference
ACC
Q9AJU0
NITE
Ello_00200
PmId
[11376004] Deoxysugar methylation during biosynthesis of the antitumor polyketide elloramycin by Streptomyces olivaceus. Characterization of three methyltransferase genes. (J Biol Chem. , 2001)

close this sectionSequence

selected fasta
>D-oliose C-4' O-methyltransferase [sugar O-methyltransferase]
MLSRGGELYLELMKRVLANVVYEDAPVGWYGDLDGYDTKARSQGLDLPTTAHTMVGLKRL
ANVQACVERVIRDKVPGDLIETGVWRGGVCILMRAVLEAYGVRDRRVWVADSFEGVPVVH
SASHPLDRDMALHRINGVLKISQEEVRENFSRYGLLDGQVDFLAGWFNETLPGAPVDSLA
VMRLDGDLYESTMDALTHLYPKLSVGGFVIIDDYNIEPCRQAVWDYRSRYGIEEPIEPVD
TCGVHWRRTG
selected fasta
>D-oliose C-4' O-methyltransferase [sugar O-methyltransferase]
ATGCTCTCAAGGGGTGGCGAGCTCTATCTGGAACTGATGAAACGGGTGCTCGCGAACGTG
GTCTACGAGGACGCCCCGGTGGGGTGGTACGGCGACCTCGACGGTTACGACACGAAGGCC
CGCTCGCAGGGACTCGACCTGCCCACGACGGCGCACACGATGGTCGGCCTGAAGCGTTTG
GCGAATGTGCAGGCGTGTGTCGAGCGGGTGATCCGCGACAAGGTCCCCGGCGACCTGATC
GAGACGGGGGTGTGGCGCGGCGGGGTCTGCATCCTGATGCGTGCGGTGCTGGAGGCGTAC
GGGGTGCGGGACCGCCGGGTGTGGGTGGCGGACTCGTTCGAGGGTGTGCCCGTCGTGCAC
TCCGCGAGTCATCCGCTGGACCGGGACATGGCGCTGCACCGCATCAACGGCGTTCTGAAG
ATCTCCCAGGAGGAGGTACGGGAGAACTTCTCCCGCTACGGACTGCTGGACGGCCAGGTC
GATTTCCTGGCGGGGTGGTTCAACGAGACTCTGCCCGGCGCACCCGTTGATTCCCTCGCG
GTGATGCGACTGGACGGGGATCTCTACGAGTCGACGATGGACGCGCTGACCCATCTGTAT
CCGAAGCTGTCGGTGGGCGGGTTCGTCATCATCGACGACTACAACATCGAGCCCTGCCGG
CAGGCGGTGTGGGACTACCGCAGCCGGTACGGCATCGAGGAGCCCATCGAGCCCGTCGAC
ACCTGCGGCGTGCACTGGCGCAGGACCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008884 Macrocin-O-methyltransferase (Family)
 [6-249]  3.70000000000004e-124 PF05711
PF05711   TylF
SignalP
 [1-18]  0.308 Signal
Eukaryota   
TMHMM No significant hit