close all open/close all

CDS information : Chro_00140


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction15,225 / 14,323 / - [in whole cluster]
15,225 / 14,323 / - [in contig]
Locationcomplement(14323..15225) [in whole cluster]
complement(14323..15225) [in contig]
TypeCDS
Length903 bp (300 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)cmmRI
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q83X29
PmId
[12791134] The large linear plasmid pSLA2-L of Streptomyces rochei has an unusually condensed gene organization for secondary metabolism. (Mol Microbiol. , 2003)
[20378964] Regulation of lankamycin biosynthesis in Streptomyces rochei by two SARP genes, srrY and srrZ. (Biosci Biotechnol Biochem. , 2010)
ACC
P25047
NITE
Adria_00210
PmId
[1729206] Regulation of secondary metabolism in Streptomyces spp. and overproduction of daunorubicin in Streptomyces peucetius. (J Bacteriol. , 1992)
[7868593] Functional characterization and transcriptional analysis of the dnrR1 locus, which controls daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[8971703] Purification and characterization of the DNA-binding protein DnrI, a transcriptional factor of daunorubicin biosynthesis in Streptomyces peucetius. (Mol Microbiol. , 1996)
[16545946] Feedback regulation of doxorubicin biosynthesis in Streptomyces peucetius. (Res Microbiol. , 2006)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative transcriptional regulator [transcriptional regulator]
MTYGYCTERIEFQLLGSLGLRTSDHPNLADELTAPKPRKIIALLVMQANHIVPTTAMARE
LWGDNPPASVQTTLQTYVLQARRLLGRALCLSPADVARRILVTKFGGYQLNVSHGSVDVN
EFARLAAEGQHAFLEGEDERAVRLLTEALDLWSGPPLVDIQAGPLLSAEIRRLEENRLTV
QMQMVDAKLRLALHDQLPGELAGLAAQYPRNENLHAQYMLALYRCGRCPDALDVFRRLRE
RLVDELGLEPSLKIQALHRAMLAADPALDHGAVPTEGNLLLDRFAPTAPGREPWATRRAG
selected fasta
>putative transcriptional regulator [transcriptional regulator]
GTGACCTACGGCTACTGCACGGAACGCATCGAGTTTCAGTTACTTGGTTCACTCGGCTTG
CGGACGTCCGACCACCCCAACCTGGCGGACGAACTCACTGCCCCCAAGCCGCGGAAGATC
ATCGCCTTGCTGGTCATGCAGGCGAACCACATCGTGCCCACGACGGCGATGGCTCGGGAA
CTGTGGGGCGACAACCCGCCCGCCAGCGTTCAGACCACGCTGCAGACCTACGTCCTCCAG
GCCCGCAGACTCCTCGGTCGCGCCCTGTGCCTCTCGCCCGCGGACGTCGCCCGGCGGATC
CTCGTCACCAAGTTCGGCGGTTACCAGCTGAACGTCAGTCACGGCTCCGTCGACGTGAAC
GAGTTCGCCCGGCTGGCCGCCGAGGGCCAGCACGCGTTCCTCGAGGGTGAGGACGAGAGA
GCCGTCCGGTTGCTGACCGAGGCCCTCGACCTGTGGAGCGGACCGCCGCTCGTAGACATC
CAGGCGGGACCGCTGCTGTCCGCGGAGATACGGCGCCTGGAGGAGAACCGGCTCACGGTG
CAGATGCAGATGGTCGACGCCAAGCTCCGTCTCGCCCTGCACGACCAGCTTCCGGGCGAA
CTGGCGGGGCTGGCCGCCCAGTACCCGAGGAACGAGAACCTGCACGCCCAGTACATGCTC
GCGCTGTACCGCTGCGGCCGCTGTCCGGACGCTCTGGACGTGTTCCGGCGGTTGCGCGAG
CGGCTCGTCGACGAGCTGGGCCTGGAGCCCTCGCTCAAGATCCAGGCCCTGCACCGGGCG
ATGCTCGCAGCCGATCCCGCCCTCGACCACGGGGCGGTCCCCACCGAAGGCAACCTGCTG
CTCGACCGGTTCGCCCCCACCGCCCCCGGCCGTGAGCCGTGGGCCACCCGCCGGGCCGGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [30-110]  9.00000407957274e-06 SM00862
SM00862   Trans_reg_C
 [33-110]  4.40000000000001e-13 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [117-262]  1.6e-46 PF03704
PF03704   BTAD
 [117-262]  6.39998633403535e-44 SM01043
SM01043   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [35-112]  4e-05 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [9-111]  2.49999811956465e-09 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-29]  0.149 Signal
Bacteria, Gram-positive   
 [1-29]  0.093 Signal
Bacteria, Gram-negative   
TMHMM No significant hit