close all open/close all

CDS information : Chro_00150


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction15,688 / 16,716 / + [in whole cluster]
15,688 / 16,716 / + [in contig]
Location15688..16716 [in whole cluster]
15688..16716 [in contig]
TypeCDS
Length1,029 bp (342 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative C-methyltransferase
Product (GenBank)C-methyltransferase
Gene
Gene (GenBank)cmmMII
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q194P8
NITE
Mith_00270
PmId
[10652287] Characterization of two polyketide methyltransferases involved in the biosynthesis of the antitumor drug mithramycin by Streptomyces argillaceus. (J Biol Chem. , 2000)
[14660589] MtmMII-mediated C-methylation during biosynthesis of the antitumor drug mithramycin is essential for biological activity and DNA-drug interaction. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>putative C-methyltransferase [C-methyltransferase]
MTKDHIPTVTRQGLLTMMSAVRRTGILRAGVELRVFDAVAGAPAGPDEVAAFCGTDPRGM
RILLNALAATGLLVKDDDRFSLAPGADSTLVTTHPDYYGDAVRLAASDYEWDAIKRLGDA
VRSGGSVMEVNAETPAYTFWEDFAALGTLNTPPIAELVARHVLPGTKERDEVKVLDIACG
HGLYGYTLAAHDPRARIWSLDWPNVLAVTENNAERLGVRDRAHFIPGDMFEVPLGGPYDV
VVVANVLHHFSTERAKRLLARTADAVRPGGQLVAIAISTGDGPPHLDPVPHLFSALMLAW
TSQGQVHPLSDYEEMVTAAGFAPPKVHGLPDNPLRVLIADRV
selected fasta
>putative C-methyltransferase [C-methyltransferase]
ATGACCAAGGACCACATACCCACCGTCACCCGCCAGGGCCTGCTGACCATGATGTCCGCG
GTACGCAGGACGGGCATCCTCCGTGCCGGGGTCGAACTACGGGTGTTCGACGCCGTGGCC
GGAGCGCCGGCCGGCCCGGACGAGGTCGCCGCCTTCTGCGGAACCGACCCGCGCGGCATG
CGCATCCTGCTCAACGCCCTCGCCGCGACAGGCCTGCTGGTGAAGGACGACGACCGGTTC
TCGCTCGCGCCGGGCGCCGACAGCACCCTGGTCACCACCCACCCTGACTACTACGGCGAC
GCCGTGCGGCTTGCCGCCAGCGACTACGAGTGGGACGCGATCAAGCGCCTCGGCGACGCG
GTGCGCTCGGGCGGTTCCGTGATGGAGGTGAACGCCGAGACACCCGCGTACACGTTCTGG
GAGGACTTCGCCGCGCTGGGCACCCTGAACACCCCGCCGATCGCGGAGCTGGTCGCTCGC
CACGTGCTGCCCGGGACGAAGGAGCGCGACGAGGTGAAGGTGCTCGACATCGCCTGCGGG
CACGGGCTCTACGGGTACACCCTGGCCGCCCACGATCCCCGCGCCCGGATCTGGTCCCTG
GACTGGCCCAACGTCCTGGCCGTCACCGAGAACAACGCGGAGAGGCTCGGGGTGCGCGAC
CGCGCGCACTTCATCCCCGGTGACATGTTCGAGGTACCGCTCGGAGGGCCGTACGACGTG
GTGGTCGTCGCCAACGTCCTGCACCACTTCTCCACCGAGCGGGCGAAGCGACTGCTGGCC
AGGACGGCCGACGCGGTCCGGCCCGGCGGACAGCTCGTCGCCATCGCGATCAGCACCGGC
GACGGGCCGCCGCACCTTGACCCCGTACCCCACCTGTTCTCGGCCCTGATGCTGGCCTGG
ACCTCCCAGGGGCAGGTGCACCCCCTCTCCGACTACGAGGAGATGGTCACCGCCGCCGGT
TTCGCGCCACCGAAGGTCCACGGCCTCCCGGACAACCCGCTGCGCGTGCTCATCGCCGAC
CGTGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [79-315]  4.6e-14 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [8-87]  1.99999999999999e-24 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [13-341]  0.000170000015610474 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit