close all open/close all

CDS information : Chro_00160


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction16,725 / 17,474 / + [in whole cluster]
16,725 / 17,474 / + [in contig]
Location16725..17474 [in whole cluster]
16725..17474 [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)NDP-4-ketoreductase
Gene
Gene (GenBank)cmmUI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q9L4S5
NITE
Urd_00250
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-4-ketoreductase]
MEIIGHGFLAGRLAPLAPAHPGTVVFAAGVSSAHSTSGPEFAREADLLHQVLERCREDHL
RLVYFSTCGSGMYGTGGHGGEDGPVFPSSPYGRHKLSMEGVLRASGVETLVLRLAYTVGW
GQRAHQLVPSLLAQIRAGAVRVHHGARRDVIHVVDVVTIVDALLAEGVSHDVVNVASGHA
VPIEEIVGHLEARLGTVARKHVQHVADDHPVSNEKLLGLLPAEARPGFGPGYYRTVIDRY
LAGQPEASA
selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-4-ketoreductase]
ATGGAGATCATCGGGCACGGGTTTCTCGCCGGCAGGCTCGCGCCCCTGGCCCCCGCGCAT
CCCGGGACCGTCGTCTTCGCGGCCGGAGTCTCGAGCGCCCACAGCACCTCCGGGCCGGAG
TTCGCCCGTGAGGCGGACCTGCTCCACCAGGTGCTGGAACGCTGCCGCGAGGACCACCTG
CGGCTCGTGTACTTCTCCACCTGCGGAAGCGGCATGTACGGCACCGGGGGCCACGGCGGC
GAGGACGGCCCGGTCTTCCCCAGCTCACCCTACGGACGGCACAAGCTGTCTATGGAGGGC
GTGCTCCGCGCCTCCGGGGTGGAGACGCTCGTCCTCCGCCTCGCCTACACCGTGGGCTGG
GGCCAGCGCGCCCACCAGCTGGTCCCGTCCCTGCTCGCACAGATCCGTGCGGGGGCCGTA
CGCGTCCACCACGGCGCCCGGCGGGACGTGATCCACGTGGTCGACGTCGTCACCATCGTC
GACGCCCTGCTCGCCGAGGGGGTGTCGCACGACGTGGTCAACGTGGCCTCCGGGCACGCC
GTACCGATCGAGGAGATCGTCGGCCATCTCGAGGCCCGGCTGGGCACCGTGGCGCGCAAG
CACGTCCAGCACGTCGCAGACGACCACCCCGTCTCGAACGAGAAGCTGCTCGGCCTCCTG
CCCGCCGAAGCCCGCCCGGGGTTCGGCCCCGGCTACTACCGGACGGTGATCGACCGGTAC
CTGGCGGGACAGCCCGAGGCCTCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [19-176]  3.1e-14 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [20-191]  3.60000000000001e-17 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-35]  0.685 Signal
Eukaryota   
 [1-27]  0.328 Signal
Bacteria, Gram-positive   
TMHMM No significant hit