close all open/close all

CDS information : Chro_00170


close this sectionLocation

Organism
StrainATCC 13273 (=NBRC 3746)
Entry nameChromomycin
Contig
Start / Stop / Direction17,530 / 18,603 / + [in whole cluster]
17,530 / 18,603 / + [in contig]
Location17530..18603 [in whole cluster]
17530..18603 [in contig]
TypeCDS
Length1,074 bp (357 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)O-methyltransferase
Gene
Gene (GenBank)cmmMI
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15112992] Biosynthesis of the antitumor chromomycin A3 in Streptomyces griseus: analysis of the gene cluster and rational design of novel chromomycin analogs. (Chem Biol. , 2004)
Related Reference
ACC
Q194P7
NITE
Mith_00280
PmId
[10652287] Characterization of two polyketide methyltransferases involved in the biosynthesis of the antitumor drug mithramycin by Streptomyces argillaceus. (J Biol Chem. , 2000)

close this sectionSequence

selected fasta
>putative O-methyltransferase [O-methyltransferase]
MTTVTTPTQIADPASAARTLLRLNTAYFQSKVLQSAVELGLFALLAEEPATAETVFGRLG
VRARPGADFLDALVGLGLLERKDGHYSNKPEAAAFLVPDAPGYLGGSIAQHARRHYRSWA
SLTDLLRNEPAADSPPATAGGDPAKVQLDFHKDFENLDNVRRLMGHMDAFNTFVAHELGR
CVDWSRHRTFLDVGGARGNVAARLVRTHGHLRGGVFDLPAVRPLFDEHMAALGTASQVGF
TAGDFFDDPLPESDVVILGHVLHDWPPAARERLLERVFAAVRPGGRVVVYDAMLTDERDD
AVALLQSLNCSIMRDGGSEYTVAECRGYVEHAGFRFESAERVESLTGDRVLIASKPS
selected fasta
>putative O-methyltransferase [O-methyltransferase]
ATGACGACCGTGACCACTCCGACTCAGATCGCCGATCCGGCATCGGCGGCCCGGACCCTG
CTGCGGCTGAACACCGCCTACTTTCAGTCGAAGGTGCTGCAGAGCGCCGTCGAGCTCGGC
CTATTCGCCCTGCTCGCCGAAGAACCCGCCACCGCCGAGACCGTCTTCGGCCGGCTGGGC
GTGCGCGCCCGGCCCGGAGCCGACTTCCTGGACGCCCTGGTCGGCCTGGGCCTGCTGGAG
CGCAAGGACGGCCACTACTCCAACAAGCCGGAGGCGGCCGCGTTCCTCGTTCCGGACGCA
CCGGGCTATCTGGGCGGGAGCATCGCCCAGCACGCCCGGCGCCACTACCGGTCCTGGGCG
TCCCTGACCGACCTGCTGAGGAACGAACCGGCCGCCGACAGCCCGCCCGCCACGGCCGGC
GGTGACCCCGCCAAGGTCCAGCTGGACTTCCACAAGGACTTCGAGAACCTGGACAACGTG
CGGCGGCTGATGGGGCACATGGATGCCTTCAACACGTTCGTCGCGCACGAGCTCGGCCGG
TGCGTGGACTGGTCCCGGCACCGCACGTTCCTCGACGTGGGCGGGGCGCGCGGCAACGTC
GCGGCACGCCTGGTCCGTACCCACGGGCATCTGCGCGGAGGCGTGTTCGACCTGCCCGCG
GTCCGCCCCCTGTTCGACGAACACATGGCGGCTCTGGGTACGGCGTCGCAGGTCGGCTTC
ACGGCGGGCGACTTCTTCGACGACCCGCTGCCCGAGTCCGACGTGGTGATCCTCGGACAT
GTCCTGCACGACTGGCCCCCGGCCGCCCGCGAGAGGCTGCTGGAACGTGTCTTCGCCGCC
GTGCGGCCCGGCGGGAGGGTCGTCGTCTACGACGCGATGCTCACGGACGAGCGCGACGAC
GCCGTCGCCCTCCTTCAGAGCCTGAACTGCTCGATCATGCGGGACGGCGGATCCGAGTAC
ACCGTGGCGGAGTGCCGCGGCTACGTGGAGCACGCGGGCTTCCGGTTCGAGTCGGCCGAG
AGGGTGGAGAGCCTGACCGGTGACCGGGTCCTCATCGCGTCCAAGCCCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [85-328]  4.6e-45 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [16-93]  1.3e-22 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-357]  6.5000009155689e-08 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit